SKU: 70703575348

Felis catus CD4, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Felis catus CD4, His tagProduct Specification Species Felis catus Synonyms T cell surface antigen T4 Leu 3 Accession P79355 Amino Acid Sequence Protein sequence (P79355, Met1 Thr413 (Lys20Glu, Ser84Cys, Val103Ile, Asn115Asp, Ser142Thr, Ser169Gly & insertions of SerThr between Thr148 and Ser149), with C 10*His)

Product Specification


Species Felis catus
Synonyms T-cell surface antigen T4/Leu-3
Accession P79355
Amino Acid Sequence

Protein sequence (P79355, Met1-Thr413 (Lys20Glu, Ser84Cys, Val103Ile, Asn115Asp, Ser142Thr, Ser169Gly & insertions of SerThr between Thr148 and Ser149), with C-10*His) MNQGAVFRHLLLVLQLVMLEAAVPQGKEVVLGKAGGTAELPCQASQKKYMTFTWRLSSQVKILESQHSSLCLTGSSKLKTRFECKKILWDQGSFPLVIKSLQIADSGIYTCEVEDKKREVELLVFGLTAKVDPSGSGGSSSTSTSTSTSTSIYLLQGQSLTLTLESPSGSNPSVQWKGPGNKSKSGVHSLSLSQLELQESGTCTCTVSQSQKTLVFNTNILVLAFRKVSNTVYAKEGEQVEFSFPLNFEDENLMGNLRWKAEGAPSSLLWISFTLKNKQLSVKEVDPYSKLQMMDSLPLRFTLPNVLSRYAGSGNLTLVLDKGQLQQEVKLVVMRVTQSGNNLTCEVLGPTSPELTLSLKLKGQAAKVSKQQKMVRVEDAEAGTWQCLLSHKDKVLLASKAEVLPPVLTRTWTGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 46.8 kDa Observed MW: 50 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD4 (cluster of differentiation 4) is a glycoprotein that serves as a co-receptor for the T-cell receptor (TCR). CD4 is found on the surface of immune cells such as T helper cells, monocytes, macrophages, and dendritic cells. CD4+ T helper cells are white blood cells that are an essential part of the immune system. They are called helper cells because one of their main roles is to send signals to other types of immune cells, including CD8 killer cells, which then destroy the infectious particle. If CD4 cells become depleted, the body is left vulnerable to a wide range of infections that it would otherwise have been able to fight. CD4 continues to be expressed in most neoplasms derived from T helper cells. The antigen has also been associated with a number of autoimmune diseases such as type I diabetes mellitus.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 70703575348

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Danielle Chen
Pawtucket, US
★★★★★ 5
Perfect Balance of Comfort, Support, and Style!
Size: 934-Z, Color: Black, Size: 934-Z, Color: Black
I’ve been using this chair for a few weeks now, and I’m genuinely impressed with how much of a difference it’s made in my workspace. The mesh back is one of my favorite features—it offers excellent breathability and prevents that sticky, overheated feeling you sometimes get with solid-back chairs, even after sitting for hours. The seat cushion is firm enough to give proper support but still has enough give to keep me comfortable through long workdays. It feels like the perfect middle ground between soft and supportive. The adjustable foot ring has been a complete game changer for me. I use a taller desk setup, and having somewhere to rest my feet makes a huge difference in posture and overall comfort. Whether I’m sitting upright for focused work or leaning back to read, it’s always at the right height. The flip-up armrests are another smart design choice. When I’m typing, I like to have them down for support, but when I’m done, I can flip them up and push the chair neatly under my desk—saving space and keeping things tidy. The casters roll smoothly on both hardwood and rugs, so I can move around easily without scraping the floor or getting stuck. The overall build quality feels solid and sturdy, with no wobbles or creaks. Assembly was surprisingly quick—everything was clearly labeled, the parts felt durable, and it only took me about 20 minutes from opening the box to sitting in the chair. The sleek, modern look is another big plus—it blends in perfectly with my home office décor without feeling bulky or taking up too much visual space. If you’re looking for a chair that combines comfort, ergonomic support, durability, and style, I can’t recommend this one enough. It’s equally great for work, studying, or just relaxing at your desk, and it’s definitely been worth every penny.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 12, 2025
S
Verified Purchase
sleepywan
Omaha, US
★★★★★ 3
OK for the price, but overall comfort is avergae
Size: 934-Z, Color: Mustard
Easy to put together, color (mustard) accurate to images, and while I understand this is not a high-end chair, I feel like it still needs to be rated for its quality. Pros: the seat cushions are fairly comfortable and it rolls well. Adjustable footrest is easy enough and mostly sturdy. Cons: For a tall office chair, it doesn't go up high enough. I actually had to lower my standing desk to sit at it, which then isn't where I want it when I'm standing now. It's also a bit wobbly. The seat area's attachment to the post isn't as solid as it should be for a tall chair, so while sitting, it does tend to lean/slope forward and wobble side to side. The lumbar support is not adjustable, so I'm not even really sure what it does. And the armrests are not very comfortable to use. Since they are hard plastic, they are just a bit too rigid to rely on for any comfort. They are basically there to hold on to when you're getting out of the chair.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
M
Verified Purchase
Mel
Chelsea, US
★★★★★ 4
Good Value for a Tall Chair
Size: 934W-Z, Color: White
I have received this chair just today and would like to give my first impressions of it. Height is super adjustable as well as the foot rest. My desk is very tall (~34 inches vs standard ~29 inches) and does not suit a standard height chair. This chair's height is enough to sit comfortably at mybut also still having adjustment to be even higher. Lumbar support is a manual adjustment that can be adjusted by sliding the lumbar piece up or down and it seems it can be tiled as well. No reclining feature or slight backrest tilt adjustment. I'm used to my chairs reclining so it feels a little awkward siting in a flat base and straight backrest. I feel like I'm sitting too forward or leaning forward slightly but is probably something I can get use to. Easy to put together and feels very sturdy. Plastic parts of chair are made from a really sturdy plastic, like playhouse plastic materials. Wheels roll around carpet easily. Mesh seems to be a strong material, though the mesh feels kind itchy on bare skin. Overall, I think this is a good chair to get if you're needing a tall chair for a good value and can sacrifice no backrest tilt.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 3, 2025
T
Verified Purchase
Tram
Fort Morgan, US
★★★★★ 5
Excellent value for money!
Size: 934W-Z, Color: Black, Size: 934W-Z, Color: Black
I absolutely love this office chair! I needed a chair that could support my standing desk without sacrificing comfort, and this one completely exceeded my expectations. It's incredibly sturdy and durable, well-made, and the height adjustment is super convenient, making it easy to find the perfect fit. Even during long hours of work, the seat is comfortable, and the ergonomic design effectively reduces pressure on my back and legs. I love its clean, modern look—it fits my home office perfectly. Assembly was quick and easy, and for this price, the quality is absolutely fantastic!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 24, 2026
L
Verified Purchase
Lisa Bjornstad
West Palm Beach, US
★★★★★ 5
Perfect chair!
Size: 934-Z, Color: Blue, Size: 934-Z, Color: Blue
I have an adjustable-height desk (also purchased from Amazon) and needed a drafting chair for those times when my body gets tired of standing. This chair fits the bill and then some! I put it together myself; it took me about an hour, but would take me about half that next time, since now I know what to do (and what NOT to do!). All the parts were there; there are even spare parts (see photo). All the holes were drilled in exactly the right places, too, which isn't always the case when I buy things from Amazon (my standing desk is a great example). The chair fits me; I'm short (5'3.5"), and often the seats of furniture are too deep for me to rest my feet flat on the floor. The depth of the seat on this chair is just a little over 18 inches, and with the adjustable footrest ring, it's perfect. I don't think a tall or heavy person would fit in it, to be honest. But it's perfect for those of us who are vertically challenged. I love that it glides easily on my hardwood floors and that it turns 360 degrees. The chair comes in numerous luscious colors, so take your pick! It is very sturdy, has good lumbar support, and the seat and seat back are very comfortable. And the arms flip up, which was an absolute must when I was shopping for this chair. I got it on sale, too -- $109.00 -- and I'm delighted with this purchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026

recommand products