SKU: 71825238319

Human IL-23/IL12Bp40&IL-23Ap19, No tag&His tag

Sale price$112.50 Regular price$125.00
Save 10%

Pay in installments of $31.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-23/IL12Bp40&IL-23Ap19, No tag&His tagProduct Specification Species Human Synonyms IL 12B, Cytotoxic lymphocyte maturation factor 40 kDa subunit (CLMF p40), IL 12 subunit p40, NK cell stimulatory factor chain 2 (NKSF2), NKSF2, IL 23 subunit alpha, IL 23 A, Interleukin 23 subunit p19 (IL 23p19), SGRF Accession P29460Q9NPF7 Amino Acid Sequence Protein sequence1 (P29460, Ile23 Ser328)

Product Specification


Species Human
Synonyms IL-12B, Cytotoxic lymphocyte maturation factor 40 kDa subunit (CLMF p40), IL-12 subunit p40, NK cell stimulatory factor chain 2 (NKSF2), NKSF2, IL-23 subunit alpha, IL-23-A, Interleukin-23 subunit p19 (IL-23p19), SGRF
Accession P29460、Q9NPF7
Amino Acid Sequence

Protein sequence1 (P29460, Ile23-Ser328) IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS; Protein sequence2 (Q9NPF7, Arg20-Pro189, with C-His tag) RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Expression System HEK293
Molecular Weight Predicted MW: 20.4 kDa(IL-23Ap19)&34.7 kDa(IL12Bp40) Observed MW: 20, 40 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Interleukin 23 (IL-23) is a heterodimeric cytokine composed of an IL-12B (IL-12p40) subunit (which is shared with IL-12) and an IL-23A (IL-23p19) subunit. IL-23 is part of the IL-12 family of cytokines. The functional receptor for IL-23 (the IL-23 receptor) consists of a heterodimer between IL-12Rβ1 and IL-23R. IL-23 is an inflammatory cytokine. It has been shown to be a key cytokine for T helper type 17 cell (Th17 cell) maintenance and expansion. IL-23 stabilises RORγt and thus enables Th17 cells to release their effector cytokines, such as IL-17, IL-21, IL-22 and GM-CSF, which mediate protection against extracellular fungi and bacteria and participate in barrier immunity. Natural killer cells also express the IL-23 receptor. IL-23 also induces proliferation of CD4 memory T cells. Besides its proinflammatory effects, IL-23 promotes angiogenesis. IL-23 imbalance and increase is associated with autoimmune diseases and cancer. Low concentrations of IL-23 support lung tumor growth whereas high concentrations inhibit proliferation of lung cancer cells. IL-23 and IL-23R were identified in serum from patients with non-small-cell lung cancer and have been proposed as prognostic serum markers. IL-23 can also promote progression of cardiovascular diseases such as atherosclerosis, hypertension, aortic dissection, cardiac hypertrophy, myocardial infarction and acute cardiac injury. In brain, IL-23 is able to activate γδ T cells to increase their expression of IL-17, which contributes to the inflammatory response and thus plays a key role in secondary brain injury after spontaneous intracerebral hemorrhage.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 71825238319

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Marybeth Kenny
Belleville, US
★★★★★ 5
Looks Even Better in Person!
Color: Rose Red
Does exactly what it says. Simple, effective, and high quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
G
Verified Purchase
G
Dallas, US
★★★★★ 5
The pooch is on Cloud No 9
Color: Blue
Lucky loves everything about this (blue) octopus. It has squeakers in all the right places and the crinkle sound adds to his fun. He’s almost 70lbs and extremely strong, and can be an aggressive player and chewer. So far, it has held up extremely well for the tug-of-war games and crazy shaking play. It’s well worth the money. I also want to mention that this toy is true to size. I have too often ordered dog toys that turned out to be much smaller than advertised.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 15, 2026
A
Verified Purchase
Amazon Customer
Boise, US
★★★★★ 5
Great buy, finally a big soft toy, and so cute
Color: Green
This octopus toy is so adorable, I’m truly so impressed with the size finally a big toy for a big dog. She loves it! It squeaks, soft, made great. Worth it! Love it! Fun, durable n chewability just for play materials soft n durable. It’s a sea foam green color and creme beautiful neutral color
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 31, 2026
K
Verified Purchase
Kay-Z
Birmingham, US
★★★★★ 5
Large, excellent toy with many squeakers!
Color: Blue, Color: Blue
This toy is excellent! I’m super happy with this purchase. My dog loves squeakers and there are so many in this toy, plus stuffing for her to rip out, and crinkle paper to take the sensory experience up another notch! It’s also more durable than many other plush-type dog toys, and is larger than expected which is a plus in my book. For size reference, both dogs are around 40lbs. I will be buying another as soon as this one is demolished!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 18, 2026
B
Verified Purchase
Birdofsong
Waukegan, US
★★★★★ 5
Huge and fun. Good for two dogs to play with together.
Color: Yellow
This dog toy is great! And it's HUGE. Each tentacle crinkles, and the dogs love to play tug-of-war with it. It seems to be holding up well, too. It seemed a bit pricy for a dog toy, but it turns out it was worth it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 11, 2026

recommand products