SKU: 71849154045

IL-18BP His Tag Protein, Human

Sale price$142.83 Regular price$158.70
Save 10%

Pay in installments of $39.67 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IL-18BP His Tag Protein, HumanProduct Specification Species Human Antigen IL 18BP Synonyms IL18BP, IL18BPa, Tadekinig alfa Accession O95998 2 Amino Acid Sequence Thr31 Gly194, with C terminal 8*His TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQGGGGSHHHHHHHH Expression System HEK293 Molecular Weight 40 50kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation

Product Specification


Species Human
Antigen IL-18BP
Synonyms IL18BP, IL18BPa, Tadekinig-alfa
Accession O95998-2
Amino Acid Sequence

Thr31-Gly194, with C-terminal 8*His TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQGGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

40-50kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1. Review Front ImmunoQl . 2013 Oct 8;4:289.

Background

Interleukin-18 binding protein, also known as IL-18BP and tadekinig-alfa, is a secreted glycoprotein that contains an Ig-like C2-type domain. IL-18BP is a cytokine receptor that belongs to the interleukin 1 receptor family. IL18BP shares many characteristics with soluble cytokine receptors of the IL1 family in that the protein exhibits specificity for IL18, belongs to the immunoglobulin-like class of receptors and has limited amino acid sequences with those of the IL1 receptor type II. According to the other study, IL1R9 is evolutionarily related to IL18BP and may function as an IL-18 receptor. Plasma il-18 /IL18BP levels increase during disease activity, suggesting that it may play a role in the pathogenesis of ITP.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 71849154045

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Cassie AReaderofRuin
Omaha, US
★★★★★ 5
The banter was bantering, and the slow burn was 🔥🥵🌶️🙌🏻
Format: Paperback, Format: Paperback
Two enemies, one desperate bargain, and an attraction that could ultimately destroy them both? I don’t know about you guys, but this was the perfect recipe for an all-night, feet kicking the air read! This book has it all: 🖤 Necromancer X Runewitch ⚔️ Norse Mythology 🖤 Deadly Quest ⚔️ OCD Rep 🖤 Enemies-to-lovers ⚔️ Morally Gray MCs 🖤 Reluctant Allies ⚔️ Feminine Rage 🔥 A slow burn so good you’ll be begging for more! What I loved: 🖤 The unique world-building. I’ve read a lot of witchy reads before, and they usually follow the same pattern, however, involving descendants of dragons (Fireborn) and Necromancers really created a unique spin to the witchy market. The rune magic system was intriguing, and in action, I found myself completely enamored with it and Thraga. 🖤 The OCD representation. Let’s be honest, if you don’t have OCD, you don’t often think about it, but to those who do experience OCD, even in minor forms, seeing a FMC with OCD was refreshing and added layers to her character. Thraga has been through so much trauma, and it translates into her OCD, showing her need to have control over some aspect of her life and body, when in reality, her OCD has taken complete control of her. Throughout the story, Durlain helps her to realize just how much the OCD (and other “things”) have taken away from her ability to truly be free. It is one of the most endearing arcs I have read in a while. 🖤 The tension and banter. This wouldn’t be a highly ranked read for me without the perfect balance of tension and toe curling banter. This is a SLOW BURN, but it is so perfectly paced and balanced. When things finally combust (and boy, do they), it is so tremendously satisfying that you don’t even care how long it took to get to that point. It was earned in every way. I highly recommend this book to any romantasy and paranormal romance enthusiast. It hits all of the right marks, and the ending will have you staring at the wall. I am going to be incredibly surprised if this doesn’t get picked up by a traditional publisher at some point, it was that good! Final rating: 4.5 ⭐️ 1.75 🌶️ 🚨 Check TWs 🚨
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 21, 2025
D
Verified Purchase
Dylan Lemox
Houston, US
★★★★★ 5
Fantastic Read!
Format: Paperback
🖤”𝑰𝒇 𝒕𝒉𝒆 𝒘𝒐𝒓𝒍𝒅 𝒉𝒂𝒅 𝒕𝒐 𝒃𝒆 𝒕𝒆𝒓𝒓𝒊𝒃𝒍𝒆, 𝑰 𝒄𝒐𝒖𝒍𝒅 𝒃𝒆 𝒔𝒐, 𝒔𝒐 𝒎𝒖𝒄𝒉 𝒘𝒐𝒓𝒔𝒆.”💜 The Death-Made Prince by Lisette Marshall is the perfect enemies to lovers read!😍🐦‍⬛💜 🖋️Review Thraga lives in a world where runewitches are killed for simply existing. Just hours from being sent to the gallows, a mysterious prisoner shows up and sets her on a path she never thought possible. When these two collide, they are never the same. This book is Lisette’s best work yet! I loved the characters, the story, and the romance. The tension between these two characters was palpable and I ATE IT UP!!! Between the fast-paced plot and the witty banter, I couldn't put this one down. The OCD rep in this book was perfection. I loved how Lisette explored grief and overcoming heartache in this one. From the magic system to the Norse lore this book was such a fantastic read. I cannot wait to read book two and explore more of this story and this amazing world the author has created. And that freaking ending!!! 🤯😳🫢 Do not sleep on this book, it has everything you want in a romantasy and more!!! If you enjoy creative magic systems, yearning and tension that will have you melting and kicking your feet, epic action and adventure, or well thought out complex characters, look no further this book is for you!! Genre: Fantasy Romance Publication Date: October 21st, 2025 Series: Runewitch Saga - Book 1 Pages: 545 ⭐️-5 🌶️-2 Tropes: 🐦‍⬛Both MCs are Morally Grey 🗡️Enemies to Lovers 💜OCD Rep 🐦‍⬛Deadly Quest 🗡️Norse Mythology 💜Necromancer & Witch 🐦‍⬛Slow Burn with Spice And More… 🚨⚠️This book has dark elements and is not suitable for all readers. Please be sure to check the trigger warnings before reading this book!⚠️🚨
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 20, 2025
A
Verified Purchase
arienwen
Draper, US
★★★★★ 4
An Unforgettable Fantasy Read
Format: Paperback
⭐️3.75/5 stars ⭐️ I can’t, in good faith, talk about this book without mentioning the end. If you are a reader who despises cliffhangers, you might want to add this to your TBR (and you’re going to want to read it) until the sequel is announced, because I am STILL reeling over that ending. This cliffhanger is the cliff that keeps on giving. It’s going to stay with me until the day I get to read Book 2. Why are you going to want to read The Death-Made Prince anyway? First and foremost is the world that Lisette Marshall has created with such a unique and refreshing magic system! I was hooked from the first mention of runes and necromancy. Linguistics is a subject that has always fascinated me, both in reality and in fantasy. Seeing Thraga’s runic witchcraft described as a formulaic language made both my mathematician and reader hearts throb with anticipation. Moreover, I loved Marshall’s take on necromancy - I didn’t realize how literal the “death-made” title for Durlain would be! In The Death-Made Prince, Marshall really does combine a variety of magical elements to create a fantasy world that is hard to leave. But what also makes The Death-Made Prince hard to ignore are the characters. Thraga and Durlain both have their tragic backstories, but it’s what lies beyond their backstories that truly make them stand out. Thraga is a runewitch with OCD and anxiety, and I just have to say that the representation is ON POINT. On the other hand, Durlain is a loveable black cat MMC who tries so hard to be an idiot (and does succeed). While their enemies-to-lovers relationship is a slow, slow, SLOW burn, it makes it all worth it in the “end.” The banter between them is top-notch and had me hooked and invested throughout. There were times when their banter was the only thing that kept me reading. The first 50% was slow and I had some trouble staying invested. BUT, I will encourage any reader who looks at my review to STICK WITH IT. The last 20-30% of the book made it oh so worth it. It really picks up once Durlain and Thraga arrive at the Dawn House (iykyk), featuring secrets, lies, and espionage. Oh, and of course the sexual tension. From then on, the plot moved quickly, and I couldn’t put my Kindle down. And then, there was the cliffhanger. But you already knew that. All in all, The Death-Made Prince introduced a fantasy world that I am loath to leave (even if for a little bit). While the beginning was slow and seemed to drag on, the end was amazing and I do not, and never will, regret reading it. Catch me again when Book 2 is announced… Thank you to Lisette Marshall and the team at Behind the Pages for letting me read an early copy of The Death-Made Prince! I’m honored to give my honest thoughts on this book and support its release.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 19, 2025
S
Verified Purchase
streetbook
Lake Worth, US
★★★★★ 5
amazing characters
Format: Kindle
These characters were fascinating. They were very damaged but also strong survivors. There was a sarcastic banter between them which I loved. The female lead grew from seeing herself as small but by the end she recognized her many strengths-which she will need to use to escape after a betrayal by the make lead. Best book that I have read in long time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
M
Megan Dodd
Charlottesville, US
★★★★★ 3
thorn of mine and in my side
Format: Kindle
This book really was a thorn in my side because I was spite reading until 60% though simply so I didn’t have to DNF it. Look. I read 2-3 books a week and it took me a week and a half to trudge through this. I don’t know why everyone is freaking out about how good it is because it’s not original, it’s boring, is so confusing, and literally put me to sleep more times than I can count. This is a 2.5⭐️ book rounded up because once I made it to 60% there was enough going on that I could follow it and my interest peaked enough to not DNF. I fear for the next book because this one needs work. I still don’t know who is who or what kingdom they belong to. Truly, this was not set up or executed well. I did however, truly love when he started calling her “thorn of mine”. I thought that was toxic cuteness at its finest. But wow, what a mess.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026

recommand products