SKU: 71927442292

Human CD69 Protein, His tag

Sale price$108.00 Regular price$120.00
Save 10%

Pay in installments of $30.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD69 Protein, His tagProduct Specification Species Human Synonyms Early activation antigen CD69, Activation inducer molecule (AIM), BL AC P26, C type lectin domain family 2 member C, EA1, Early T cell activation antigen p60, GP32 28, Leukocyte surface antigen Leu 23, MLR 3, CLEC2C Accession Q07108 Amino Acid Sequence Protein sequence (Q07108, Ser62 Lys199, with C His tag)

Product Specification


Species Human
Synonyms Early activation antigen CD69, Activation inducer molecule (AIM), BL-AC/P26, C-type lectin domain family 2 member C, EA1, Early T-cell activation antigen p60, GP32/28, Leukocyte surface antigen Leu-23, MLR-3, CLEC2C
Accession Q07108
Amino Acid Sequence

Protein sequence (Q07108, Ser62-Lys199, with C-His tag) SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

Expression System HEK293
Molecular Weight

Predicted MW: 17.7 kDa Observed MW: 20-25 kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD69 (Cluster of Differentiation 69) is a human transmembrane C-Type lectin protein. It is an early activation marker that is expressed in hematopoietic stem cells, T cells, and many other cell types in the immune system. It is also implicated in T cell differentiation as well as lymphocyte retention in lymphoid organs. The activation of T lymphocytes and Natural Killer (NK) cells, both in vivo and in vitro, induces expression of CD69. This molecule, which appears to be the earliest inducible cell surface glycoprotein acquired during lymphoid activation, is involved in lymphocyte proliferation and functions as a signal-transmitting receptor in lymphocytes, including natural killer (NK) cells, and platelets.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 71927442292

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Omaha, US
★★★★★ 5
amazing.
Item Package Quantity: 4, Size: Queen
WOW. I was really skeptical, but the other reviews are spot on: these are amazing firm pillows. I really hope they don't lose their firmness and become lumpy like other pillows tend to do. Excellent pillows for the price!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026
M
Verified Purchase
Moranda
Bozeman, US
★★★★★ 5
Great quality!! Great price
Item Package Quantity: 2, Size: Queen
Bought these for my mom and omg i like them better than the ones I got on Amazon theyre super comfy and they bounce back up they dont flatten and im definitely buying some next for me definitely worth the place great price and the make seems real good quality
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
M
Verified Purchase
Mack Mackenzie
San Leandro, US
★★★★★ 4
These are very thick pillows.
Item Package Quantity: 2, Size: Queen
Exactly as advertised. They are very firm and very thick. They're too thick for me to be able to use as bed pillows. However, they seem to work pretty well as cushions in my papasan chair on top of its normal cushion also work very well as decorative pillows. I'm still giving them four stars because they're exactly as advertised and they seem well made. My only complaint is that they're just too thick. And that's definitely not the fault of the pillows or the pillow maker.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
R
Verified Purchase
Rafael A
Draper, US
★★★★★ 5
⭐⭐⭐⭐☆ Comfortable pillows with good support
Color: White, Size: Queen (Pack of 2)
I purchased the EIUE Hotel Collection bed pillows (2 pack) looking for something comfortable and supportive, and overall they’ve been a good addition to my bed. The pillows arrived well packaged and fluffed up nicely after opening. They feel soft but still provide decent support for sleeping. I’m mostly a side and back sleeper, and these pillows have worked well without feeling too flat. They hold their shape better than I expected and don’t require constant fluffing during the night. The fabric feels smooth and breathable, which helps keep them comfortable. My only small downside is that they’re slightly softer than what I personally prefer, but that really comes down to personal preference. Overall, these are comfortable, good-quality pillows that offer nice support and value for the price. I’d recommend them if you’re looking for hotel-style pillows that are soft yet supportive.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 15, 2025
S
Verified Purchase
Shannon 71
Birmingham, US
★★★★★ 5
Cheap comfy quick delivery
Color: Black, Size: Queen (Pack of 2)
I bought these for my daughter and her dude, they love them! They aren't expensive very comfortable came to life quickly. If your looking for a quick delivery inexpensive and comfy this is your pillow. From what I've seen of them fluffy but not too fluffy 😉
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026

recommand products