SKU: 72073438936

Mouse IL-13 Protein, His tag

Sale price$130.50 Regular price$145.00
Save 10%

Pay in installments of $36.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse IL-13 Protein, His tagProduct Specification Species Mouse Synonyms Interleukin 13, T cell activation protein P600, Il13 Accession P20109 Amino Acid Sequence Protein sequence (P20109, Ala19 Phe131, with N His tag) APGPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF Expression System HEK293 Molecular Weight Predicted MW: 14. 6 kDa Observed MW: 15 33 kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation

Product Specification


Species Mouse
Synonyms Interleukin-13, T-cell activation protein P600, Il13
Accession P20109
Amino Acid Sequence

Protein sequence (P20109, Ala19-Phe131, with N-His tag) APGPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Expression System HEK293
Molecular Weight Predicted MW: 14.6 kDa Observed MW: 15-33 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with N-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Interleukin 13 (IL-13) is a protein that in humans is encoded by the IL13 gene. The secondary structural features of IL-13 are similar to that of Interleukin 4 (IL-4); however it only has 25% sequence identity to IL-4 and is capable of IL-4 independent signaling. IL-13 is a cytokine secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. Interleukin-13 is a central regulator in IgE synthesis, goblet cell hyperplasia, mucus hypersecretion, airway hyperresponsiveness, fibrosis and chitinase up-regulation. It is a mediator of allergic inflammation and different diseases including asthma.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 72073438936

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
CamRam
Whiting, US
★★★★★ 5
Asurion is AWESOME!
Ok, so let me start with the fact that you should NOT waste your time calling Amazon's customer service if you think you have a claim under Asurion's monthly protection plan. CALL ASURION! I wasted almost an hour with Amazon representatives that have absolutely no training in how the Asurion plan works, or even any idea if my item was covered. In fact, they told me the mechanized chair I purchased under the plan wasn't covered! Finally, my call got escalated to a manager who was just as clueless about my coverage, but had the best idea ever... call Asurion! The smartest thing I did that morning was hang up with Amazon, and reach out to Asurion as I should have done in the first place. Dealing with Asurion's customer service, after my Amazon call, was like being elevated to VIP status! 😄 Asurion's rep nicely took all my info, including the chair's purchase date and order number. Then they asked that I upload a couple of pictures of the product, along with a written description of the malfunction I had mentioned over the phone. This is where it gets really good. They told me they'd review the claim to determine if they'd send a repair specialist or reimburse me the cost of the item. In less than 48 hours, they determined that a payout was in order, and sent me an email that included an Amazon gift card for the total cost of the item minus the taxes I had paid, which I loaded directly into my Amazon wallet. Apparently, Asurion does not include the purchase taxes in their coverage. But, I can live with that. All in all, Asurion's claims division get a double thumbs up 👍🏽👍🏽, and the company gets big ups from me for not only standing behind their protection plan, but doing so expeditiously! Special note: If you buy a lot of stuff from Amazon, and have Asurion's monthly protection plan, scroll the item listing before pulling the trigger on your purchase... you need to see the green streamer that indicates your product is protected by the plan. If you don't see that, check to see if there are alternative products that might be covered. There are very few electronic or high ticket items that aren't covered, but looking for that green banner in the item description that says it's covered is key to foregoing any future headaches.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
S
Verified Purchase
Shance L McGuffey
Waukegan, US
★★★★★ 5
If they can't fix it they will replace it.
This protection plan that i pay monthly for paid for itself ten fold. My 3D printer just quit working and after the manufacturer warrenty had ran out at that. I submitted my claim they emailed me a shipping label in which I shipped out my printer that same day. Two days later they received my printer determined it couldc not be fixed and sent me a Amazon gift card for the full price of my printer. Today I will be receiving my new 3d printer thanks to Complete Protect. I highly recommend anyone and everyone to purchase this policy. This warrenty is like having a home warrenty like Homeshield but for your electronics and probably other stuff that i just have not read to see what else. This insurance will save me so much money over the corse of this year and every year after that. Thank you Complete Protect.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
N
Verified Purchase
nicolas juarez
Battle Creek, US
★★★★★ 5
"Outstanding support and a seamless process!"
Great experience with Asurion insurance through Amazon. I wasn't sure how to register my items for the monthly plan, but the customer support team in the chat was incredibly efficient and guided me through the entire paperwork process smoothly. Furthermore, the service I received at the repair shop (Break Fix) was excellent. The whole process was seamless, and I received my digital gift card without any issues, which I’ve already applied to my Amazon account. I am very grateful for their professionalism and how easy they made everything. Highly recommended!"
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 10, 2026
T
Verified Purchase
Toveth Noyse
Natrona Heights, US
★★★★★ 5
Received giftcard money to replace my plan-protected malfunctioning motherboard
I've been subscribing to the Asurion protection plan for a while. Recently, an Asus Prime PC motherboard I had bought a few months ago on Amazon stopped working well. I ended up considering filing a claim with Asurion to see if they would either fix/replace it or issue the purchase price money, so I could buy the failed electronics replacement component again for my custom-built PC. I went to the protection plan's website and started the claim filing process but couldn't find the category my failed component would be under in order to select it from the drop-down list. I ended up messaging the live customer service. The chat messaging was somewhat slow, the agent told me they were experiencing some communication delays throughout their systems. Ultimately, the agent was very kind and understanding, and completed the claim filing process for me on her side by asking me to provide the necessary info such as the item's product name, date of purchase, price before taxes, etc. I received a printable UPS shipping label in the email, printed it, and returned the item in the mail. Approximately 2 days later, I received an Amazon giftcard code in the email with the dollar amount equal to the item's price before the sales tax. Then I redeemed the giftcard code on the Amazon page and proceeded to apply the giftcard money to my next purchase of a replacement Asus prime motherboard, and it all worked out successfully. Therefore, I had no issues with the protection plan service and recommend it to others.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
S
Verified Purchase
Steve
Lake Worth, US
★★★★★ 4
Fast and easy but I dont trust the process to be fully automated.
The process was very smooth and fairly quick. The only challenge I had was that the CLAIM status showed complete but I had to manually go look up the status. There was no email or notification it was closed. After manually checking the status, I called customer support and they said since I called in, they would process the payout. I wonder if I didnt call in if they would have processed it? Also, the phone rep said they would issue me a amazon egift card but then the next day I received a email saying they mailed out the payout. Very poor communication but so far the process was easy and fast.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 1, 2026

recommand products