SKU: 72210474835

Human YWHAQ/14-3-3 theta Protein, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human YWHAQ/14-3-3 theta Protein, His TagProduct Specification Species Human Synonyms 14 3 3 protein theta, 14 3 3 protein T cell, 14 3 3 protein tau, Protein HS1, YWHAQ Accession P27348 Amino Acid Sequence Protein sequence (P27348, Met1 Asn245, with C His Tag)

Product Specification


Species Human
Synonyms 14-3-3 protein theta, 14-3-3 protein T-cell, 14-3-3 protein tau, Protein HS1, YWHAQ
Accession P27348
Amino Acid Sequence

Protein sequence (P27348, Met1-Asn245, with C-His Tag) MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Expression System E.coli
Molecular Weight

Predicted MW: 29.5 kDa Observed MW: 30 kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

YWHAQ, also known as 14-3-3 tau (τ), is a member of the highly conserved 14-3-3 family of phosphoserine/phosphothreonine-binding proteins. It functions as a key regulatory adapter molecule in eukaryotic cells. By binding to specific phosphorylated client proteins, YWHAQ modulates their activity, stability, subcellular localization, and participation in protein complexes. It is involved in a wide array of vital cellular processes, including signal transduction, cell cycle control, apoptosis, and metabolism. The protein plays a significant role in immune cell signaling and has been implicated in the pathogenesis of cancers and neurodegenerative diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 72210474835

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kelly C.
Port Orchard, US
★★★★★ 5
The best lip balm!
I’m so addicted to this lip balm!!! If you have secret chapped lips this will fix it in a day or two!!! And even if u don’t, it keeps your lips soooo soft!!! A bit pricey but it goes on sale a lot so watch for that.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 10, 2025
L
Verified Purchase
Laureleaves
Dallas, US
★★★★★ 4
Amazing product but star down on price
I desperately needed a healing lip balm for my perpetually chapped and scarred lips, and at first was skeptical that this was nothing but a glorified aquaphor, which works well enough for me but I was curious about better treatments. After some weeks of regular use, my lips feel incredible. I am sold. I only wish two things: that it was a smidgen cheaper, and that there was a version with SPF so I could have one to wear out during the day and have it’s magic working all the time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2024
L
Verified Purchase
LA and BM
Waukegan, US
★★★★★ 5
Fantastic for rosacea, PD, atopic dermatitis, dry skin
I’ve been using this for close to a year and it is amazing for my super sensitive and dry skin. I have perioral dermatitis, atopic dermatitis, and rosacea and live in Minnesota with bitter cold and the heater running over half the year. Cicalfate cream doesn’t flare any of these and it helps reduce redness and completely resolves dry skin. I use about a pea size amount AM and PM,, apply to dry skin, massage in, then mist with the Avene thermal water spray. Although the cream is thick, the slight white cast absorbs within a few minutes. I do not wear foundation so I don’t know how this affects it.it doesn’t burn my eyes and I’m a contact lens wearer. A big tube of cream lasts me the better part of a year.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 28, 2025
P
Verified Purchase
P. Lau
Lexington, US
★★★★★ 5
Great for harsh winters
I was recommended this product by ChatGPT as an effective and safe product that my wife (who is currently nursing) can use. We have been very mindful of certain additives and chemicals in our products and this was able to meet our requirements. Separately in the harsh winter in the northeast, this has been extremely effective in protecting the lips
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 29, 2026
G
Verified Purchase
GG
Lowell, US
★★★★★ 1
Ruined by Reformulation
New formula update: They ruined this product by reformulating. Used to be so hydrating, long-lasting, and the only thing that gave me relief from eczema. Now it is somehow SO drying, oily, and all around terrible. Judging by reviews here and on their website many customers are unhappy with the change. Done with Avene. Original five star review: This is a great all around lip balm, but if you struggle with perioral dermatitis/eczema then you NEED this. If I'm experiencing a flare, I slather on cicalfate+ at night but I can't exactly walk around with that during the day which is where this lip product comes in. It is calming, hydrating, and long-lasting. I have gone through more tubes than I can count. This was my first time ordering through amazon and I am happy to report I received authentic Avene.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2022

recommand products