SKU: 73714798192

JAM-C Fc Chimera Protein, Human

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

JAM-C Fc Chimera Protein, HumanProduct Specification Species Human Antigen JAM C Synonyms CD323; JAM 2; JAM3; JAMC; JAM C; JAM CFLJ14529; junctional adhesion molecule 3JAM 3; junctional adhesion molecule C Accession Q9BX67 Amino Acid Sequence Val32 Asn241, with C terminal Human IgG Fc

Product Specification


Species Human
Antigen JAM-C
Synonyms CD323; JAM-2; JAM3; JAMC; JAM-C; JAM-CFLJ14529; junctional adhesion molecule 3JAM-3; junctional adhesion molecule C
Accession Q9BX67
Amino Acid Sequence

Val32-Asn241, with C-terminal Human IgG Fc VNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLNIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 57-65kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Chavakis, T. et al. (2003) Thromb. Haemost. 89:13.2.Aurrand-Lions, M. et al. (2001) Blood 98:3699.3.Spermatid differentiation requires the assembly of a cell polarity complex downstream of junctional adhesion molecule-C.Gliki G., Ebnet K., Aurrand-Lions M., Imhof B.A., Adams R.H.4.Antibody against junctional adhesion molecule-C inhibits angiogenesis and tumor growth.Lamagna C., Hodivala-Dilke K.M., Imhof B.A., Aurrand-Lions M.

Background

The family of junctional adhesion molecules (JAM), comprised of at least three members, are type I transmembrane receptors belonging to the immunoglobulin (Ig) superfamily. These proteins are localized in the tight junctions between endothelial cells or epithelial cells. Some family members are also found on blood leukocytes and platelets.Junctional adhesion protein that mediates heterotypic cell-cell interactions with its cognate receptor JAM2 to regulate different cellular processes.Plays a role in homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow.At the surface of bone marrow stromal cells, it contributes to the retention of the hematopoietic stem and progenitor cells expressing JAM3.Plays a central role in leukocytes extravasation by facilitating transmigration through the endothelium.Plays a role in spermatogenesis where JAM2 and JAM3, which are respectively expressed by Sertoli and germ cells, mediate an interaction between both cell types and play an essential role in the anchorage of germ cells onto Sertoli cells and the assembly of cell polarity complexes during spermatid differentiation.Also functions as a counter-receptor for ITGAM, mediating leukocyte-platelet interactions and is involved in the regulation of transepithelial migration of polymorphonuclear neutrophils (PMN).Plays a role in angiogenesis.Plays a role in the regulation of cell migration.During myogenesis, it is involved in myocyte fusion.Promotes chemotaxis of vascular endothelial cells and stimulates angiogenesis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 73714798192

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Michael S
Fort Morgan, US
★★★★★ 5
Slip ons worth slipping on…
Size: 9.5, Color: Black, Size: 9.5, Color: Black
Very stylish and comfortable. I love how light they are because I’m on my feet all day. The black leather is very deep and very rich. The elevated sole gives me a tad more height, too…which I like. And yes, they’re slip ons. Don’t let the laces fool you. For under $40, these shoes are a strong value to consider…
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
B
Verified Purchase
Boss Babe
Phoenix, US
★★★★★ 5
I feel I’m walking on clouds
Size: 10, Color: Brown
I’m on my feet 6–8 hours a day working at the dealership, constantly walking the lot and helping customers—and I’ve gone through a lot of shoes trying to find something that actually holds up. These Bruno Marc MaxFlex Dress Sneakers honestly surprised me. They look sharp and professional enough for work, but feel more like a comfortable athletic shoe than a stiff dress shoe. From day one, there was no break-in period, no soreness, just all-day comfort. I feel I’m walking on clouds! If you’re in a job where you’re standing or moving around a lot but still need to look polished, these are hands down the most comfortable work shoes I’ve owned.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
B
Verified Purchase
Bryan Combs
Boise, US
★★★★★ 5
Dress shoes
Size: 9, Color: Light Brown/Coffee
Very comfortable and well made shoes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
E
Verified Purchase
erick
Bozeman, US
★★★★★ 3
Runs big
Size: 10, Color: Black
Too big , looks okay. Try 1 size down
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
C
Verified Purchase
Chris
Charlottesville, US
★★★★★ 5
Good value
Size: 12, Color: Black/White
Very good. Pretty comfortable and look sharp. Can't beat it for the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026

recommand products