SKU: 74098051915

Cyclophilin A His Tag Protein, Human

Sale price$94.50 Regular price$105.00
Save 10%

Pay in installments of $26.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Cyclophilin A His Tag Protein, HumanProduct Specification Species Human Antigen Cyclophilin A Synonyms Peptidyl prolyl cis trans isomerase A, PPIase A, Cyclosporin A binding protein, Rotamase A Accession P62937 Amino Acid Sequence Met1 Glu165, with C terminal 8*His MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLEHHHHHHHH Expression System E. coli Molecular Weight 20kDa

Product Specification


Species Human
Antigen Cyclophilin A
Synonyms Peptidyl-prolyl cis-trans isomerase A, PPIase A, Cyclosporin A-binding protein, Rotamase A
Accession P62937
Amino Acid Sequence

Met1-Glu165, with C-terminal 8*His MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLEHHHHHHHH

Expression System E.coli
Molecular Weight 20kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris,250mM NaCl, pH 6.0
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Cell Death Dis. 2013 Oct 31;4(10):e888.
2. Biochemistry (Mosc). 2022 Mar;87(3):259-268.

Background

Cyclophilin A (CyPA, 18 kDa) is a ubiquitously distributed protein belonging to the immunophilin family. Cyclophilin A (CyPA) is a peptidyl-prolyl cis-trans isomerase that exists in the intracellular and secretory forms and has multiple functions. Intracellular CypA takes part in folding, transport, and assembly of proteins; regulates cell proliferation; is a ligand for cyclosporine A (CsA), mediating its immune-suppressive activity; mediates signal transduction from a T cell receptor, and controls the balance of T helpers 1 and 2, inhibiting activity of T helpers 2.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 74098051915

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tr
San Leandro, US
★★★★★ 5
Great buy
Color: Pinkish Grey, Size: 14-Inch
Great backpack for computer. I like that I can transport my computer and other homework supplies in a small, fashionable backpack
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
M
Verified Purchase
Miss HLAvant
San Leandro, US
★★★★★ 5
Perfect Small-ish Business Bag
Color: Apricot, Size: 14-Inch
I have been on the search for a small business bag, that can go on. top of my luggage as well as look nice in the office and at meetings. That will still hold all of my things while keeping me organized. So what fits, I can put my 12.9" iPad, with case and Magic Keyboard in the spot for a laptop. I can also put my 8x10 spiral bound planner, a notebook, mouse, small cable case, pencil case, water bottle and purse pouch with all my essentials. So my water bottle does not fit inside the side bottle pockets, so I do have to put it inside the bag it's self, but that's a no issue. The shoulder straps seem sturdy enough and the color beige/cream looks nice with my neutral wardrobe. Overall I'm happy with the purchase. We'll see how it travels over the next year as I have quite a bit of traveling and work do to offsite this year. j
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 17, 2023
F
Verified Purchase
FlyCoolChick
Lexington, US
★★★★★ 4
Stylish, High-Quality Backpack. A Great Upgrade from My Usual Black Bags!
Color: Pinkish Grey, Size: 14-Inch
I’m really impressed with this backpack. I usually stick to black bags, but I decided to try something different, and I’m so glad I did. The color is beautiful—unique without being too loud—and adds a nice pop. The quality of the material feels top-notch. It’s sturdy yet lightweight, and the stitching and zippers seem very durable. Overall, this backpack feels well thought out in both design and function. Highly recommend if you’re looking for something professional, stylish, and practical.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 25, 2025
P
Verified Purchase
Paola
Charlottesville, US
★★★★★ 5
Buena compra
Color: Apricot, Size: 14-Inch
Calidad, Color, espacio.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026
V
Verified Purchase
Vivian
New York, US
★★★★★ 3
Gorgeous, but some big downsides
Color: Pink-upgrade, Size: 14 Inch
I wanted to like this bag SO BADLY. I’ve owned other backpacks by this brand and they have never disappointed. This one though, was a close miss. The color is absolutely GORGEOUS and I almost kept it for that reason alone. However, two big things made me return it: 1) The inside is no longer padded. If you had purchased older Golf Supags backpacks, the interior had padding to help the backpack keep its shape and not slouch over on the floor. That’s gone, so this one does flop over a little. But the big deal breaker: 2) holy cannoli, these straps are WAY too long! On the shortest length, the backpack is still hanging almost halfway down my back. It looks weird, but it’s also not ergonomically good for your back. The actual strap part (with padding) is so far back that the thin seatbelt adjustable material is the only thing on my shoulders. Super awkward. I’m not necessarily a small person either, so I shudder to think what this would look like on someone more petite than me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 15, 2025

recommand products