SKU: 74907072682

Human TMED4 Protein, His Tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 12 - Aug 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human TMED4 Protein, His TagProduct Specification Species Human Synonyms Transmembrane emp24 domain containing protein 4, Endoplasmic reticulum stress response protein 25 (ERS25), GMP25iso, Putative NF kappa B activating protein 156, p24 family protein alpha 3 (p24alpha3), ERS25 Accession Q7Z7H5 Amino Acid Sequence Protein sequence (Q7Z7H5, Leu30 Arg194, with C His Tag)

Product Specification


Species Human
Synonyms Transmembrane emp24 domain-containing protein 4, Endoplasmic reticulum stress-response protein 25 (ERS25), GMP25iso, Putative NF-kappa-B-activating protein 156, p24 family protein alpha-3 (p24alpha3), ERS25
Accession Q7Z7H5
Amino Acid Sequence

Protein sequence (Q7Z7H5, Leu30-Arg194, with C-His Tag) LYFHIGETEKRCFIEEIPDETMVIGNYRTQMWDKQKEVFLPSTPGLGMHVEVKDPDGKVVLSRQYGSEGRFTFTSHTPGDHQICLHSNSTRMALFAGGKLRVHLDIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYREERFRLTSESTNQR

Expression System HEK293
Molecular Weight Predicted MW: 20.9 kDa Observed MW: 20 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Transmembrane emp24 domain-containing protein 4 (TMED4) is a member of the p24 family of type I transmembrane proteins, which are involved in endoplasmic reticulum (ER)-to-Golgi vesicular transport. It functions as a cargo receptor, facilitating the selective packaging of glycosylphosphatidylinositol (GPI)-anchored proteins and other specific clients into COPII-coated transport vesicles. TMED4 forms hetero-oligomeric complexes with other family members to ensure efficient cargo sorting and maintenance of cellular homeostasis. Its role is crucial for proper protein secretion and cellular trafficking pathways. Dysregulation of TMED4 has been implicated in certain diseases, including cancer.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 74907072682

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Donna Woods
Bozeman, US
★★★★★ 5
Love this
Style: Pawsitively Fresh
These are the only candles I burn. I have three dogs and a cat, and sometimes some stinky grandkids lol. Everyone comments on how fresh it smells.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 31, 2026
T
Verified Purchase
Tiffany Freeman
Carnegie, US
★★★★★ 5
Best odor eater candle I’ve ever tried!
Style: Pawsitively Fresh
I stumbled across this product while trying to find some candles which would help mask my puppies’ “aroma” … they’re wonderful. While they don’t really have a scent to them (even though they say they do) they do minimize the odor ALOT. As an example, our one puppy just was sick and I lit this in his room to help eliminate the stink left behind. Worked so well! My puppies and I are very thankful, because as anyone with pets knows … that stink after a sick animal will burn your nostrils for days 😩
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 22, 2026
K
Kirsche
Battle Creek, US
★★★★★ 4
Not sure it's pure Batana oil
I'm not a botanical expert, so I may be totally wrong about this, but based on the ingredients, I don't think this is pure Batana Oil. The ingredient list (typos included) reads: "Elaeis Oleifera Kernel Oil, Babassuamide DEA, AscorbicAcid, Phytosterols, Carotenoids, Vitamins c." The last 4 ingredients might just be components of the oil itself, rather than additives. But Elaeis Oleifera (American Palm) Kernel Oil is Batana oil. But Babassuamide DEA is an oil that comes from the kernels of the babassu palm, not the American palm. Sure, it's still "palm kernel oil", but if I wanted just any ol' palm kernel oil, then I'd use some out of the cooking oil bottle in the kitchen and save myself a buck. I wanted 100% Pure Batana oil. I also can't figure out why the description talks about it containing Vitamin E, when that isn't listed as an ingredient. If it's been added, then it definitely needs to be listed on the package. If it's a natural chemical part of the oil itself, and the same is true of the Vitamin C listed, then why not list both separately? Or is the Vitamin C listed because it's been added despite them saying it's pure Batana oil? I don't know. So if you just want some kind of palm kernel oil to moisturize your hair, and you're not particular about whether or not it's really pure Batana oil, then this might be the oil for you. But, if you're a stickler for purity, maybe not. And there are lots of cheaper Batana-type palm oils out there that aren't true Batana, if price is more important to you than purity.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
A
Verified Purchase
Anthony Brown
Cuba, US
★★★★★ 5
a miracle in a jar
Scent: Earthy, Nutty, Refreshing, Size: 4.06 Fl Oz (Pack of 1)
This item did exactly what it was expected to do, and I couldn’t be happier with my purchase. It works as described, is easy to use, and the overall quality exceeded my expectations. The price was great for what you get, making it an excellent value. Everything about it—from performance to convenience—has been spot on. My sister has noticed an extreme growth in her hair since using this product. I’m very satisfied and would definitely recommend this to anyone looking for something reliable and well worth the money!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
C
Verified Purchase
Connie V. Yancey
Whiting, US
★★★★★ 5
New growth.
Scent: Earthy, Nutty, Refreshing, Size: 4.06 Fl Oz (Pack of 1)
I like this and I think it is really growing my edges back. I will keep on using it. Did not want to post pictures yet.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2026

recommand products