SKU: 75199518192

Rhesus macaque TNFSF15 Protein, His Tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 12 - Aug 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rhesus macaque TNFSF15 Protein, His TagProduct Specification Species Rhesus macaque Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand related molecule 1, Vascular endothelial cell growth inhibitor, TNLG1B Accession F6S8F9 Amino Acid Sequence Protein sequence (F6S8F9, Leu72 Leu251, with N His Tag)

Product Specification


Species Rhesus macaque
Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor, TNLG1B
Accession F6S8F9
Amino Acid Sequence

Protein sequence (F6S8F9, Leu72-Leu251, with N-His Tag) LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHLKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFVYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Expression System HEK293
Molecular Weight Predicted MW: 22.1 kDa Observed MW: 25-30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

TNFSF15 (Tumor Necrosis Factor Superfamily Member 15), also known as TL1A, is a cytokine that binds to death receptor 3 (DR3) and decoy receptor 3 (DcR3). It plays a key role in modulating immune responses, particularly in T-cell activation, inflammation, and autoimmune diseases. TNFSF15 is highly expressed in endothelial cells and contributes to angiogenesis and vascular remodeling. Dysregulation of TNFSF15 is linked to inflammatory disorders (e.g., Crohn’s disease, rheumatoid arthritis) and cancers. Its dual role in pro-inflammatory and anti-angiogenic signaling makes it a potential therapeutic target for immune-mediated and vascular diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 75199518192

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
H
Verified Purchase
Her name is Bella
Alexandria, US
★★★★★ 2
They fade
Size: 14, Color: Black
The are nice but fade after the 1st wash
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
A
Verified Purchase
Anonymous
Chelsea, US
★★★★★ 4
Little big
Size: 20, Color: Rinse Wash
They run just a tiny bit big. The length is more ankle length instead of capri length as shown. However, I liked the wash and the length doesn't bother me. Perfect match to the essentials jacket.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 17, 2025
H
Verified Purchase
Haley D
Louisville, US
★★★★★ 5
good stretch
Size: 10 Long, Color: Dark Wash
Honestly, these are one of those surprisingly good basics—especially for the price. The biggest standout is the stretch. They’re really comfortable and move with you, so they don’t have that stiff “jeans” feeling. They hug your body in a flattering way without feeling too tight or restrictive, which makes them easy to wear all day. The mid-rise fit is also a sweet spot—not too low, not too high—so they’re super versatile with different tops. What I liked: Very stretchy and comfortable (almost feels like jeggings, but still looks like denim) Flattering skinny fit through the legs Easy everyday jeans—work, errands, going out Great value for the price What to know: Material is on the thinner side (more comfort than “structured denim”) They can lose shape slightly after a full day of wear Not the most durable long-term compared to higher-end denim Final thoughts: These are perfect if you want cute, comfortable, affordable jeans you can throw on with anything. Not premium denim, but for everyday wear—they definitely get the job done and are worth having in your rotation.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
D
Verified Purchase
Debra R Singleton
Battle Creek, US
★★★★★ 5
Amazon Essentials Women's High Stretch Jeans
Size: 14, Color: Iced Blue Light Wash
Amazon Essentials Women's High Stretch Jeans receives positive reviews from me for their significant stretch, comfort, and flattering fit. The jeans are great for everyday wear, they feel soft and thick yet move well. Although some folks find sizing inconsistent, occasionally needing to size up or experiencing a slightly odd fit in certain areas. They're praised for looking good, offering good value, and being versatile enough for various occasions. Sizing can be hit-or-miss for some, but not for me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 31, 2025
A
Verified Purchase
Amazon Customer
Phoenix, US
★★★★★ 5
Super comfortable
Size: 8, Color: White
These are high quality fabric.. Not thin and flimsy buy good fabric. Fit me like a glove. I love them and they are very comfortable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026

recommand products