SKU: 75873897989

Mouse IgG kappa, His tag

Sale price$117.00 Regular price$130.00
Save 10%

Pay in installments of $32.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 1 - Aug 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse IgG kappa, His tagProduct Specification Species Mouse Synonyms Ig kappa chain C region MOPC 21 Accession P01837 Amino Acid Sequence Protein sequence (P01837, Arg1 Cys107, with C 10*His) RADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNECGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 13. 6 kDa Observed MW: 13. 6 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical

Product Specification


Species Mouse
Synonyms Ig kappa chain C region MOPC 21
Accession P01837
Amino Acid Sequence

Protein sequence (P01837, Arg1-Cys107, with C-10*His) RADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNECGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 13.6 kDa Observed MW: 13.6 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin kappa constant, also known as IGKC, is a gene that encodes the constant domain of kappa-type light chains for antibodies. The immunoglobulin light chain is the small polypeptide subunit of an antibody (immunoglobulin). A typical antibody is composed of two immunoglobulin (Ig) heavy chains and two Ig light chains. kappa (κ) chain is one of the two types of light chain in humans. A free light chains test measures the amount of lambda and kappa free light chains in the blood. If the amount of free light chains is higher or lower than normal, it can mean you have a disorder of the plasma cells. These include multiple myeloma, a cancer of plasma cells, and amyloidosis, a condition that causes a dangerous buildup of proteins in different organs and tissues.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 75873897989

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kathia Colon
Bozeman, US
★★★★★ 5
Durable, Odorless, and Reliable — A Must‑Have 3‑Pack
Size: 3Pack 16"x20" Black
I’m really impressed with this 3 Pack PTFE Teflon Sheet for Heat Press (16 x 20"). The quality is excellent, and the non‑stick surface makes every press come out clean and smooth. One thing I really appreciate is that there’s absolutely no smell, even when using high heat. It makes the whole process more comfortable and professional. These sheets offer great protection for both the heat press and the materials. They prevent scorching, keep the plates clean, and stop any vinyl or ink from sticking. My projects come out more consistent because the sheets help distribute heat evenly and act as a reliable barrier. The 3‑pack is a huge bonus. I keep one on my press, one as a backup, and one for different materials like HTV or sublimation. It saves time and keeps everything cleaner when I’m working on multiple items. The 16 x 20 size is perfect for shirts, tote bags, and larger designs, and the sheets stay flat without curling. If you want something that protects your equipment, has no smell, and delivers clean results every time, this set is definitely worth it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 18, 2025
V
Verified Purchase
Vicki P.
Port Orchard, US
★★★★★ 5
T shirt Quilt Use
Size: 3Pack 16"x20" Black
I bought this specifically for ironing interfacing onto t-shirts before cutting into squares. Some of the memory t-shirt's had ‘puffy paint’ and other shirts had uncertain designs that may be ruined by ironing without protection or by using just a pressing cloth (cotton material). A teflon sheet was suggested on a you tube video to ‘play it safe’ when making a memory quilt. I felt the heat resistance teflon helped because you need to hold iron in same place for a longer time than ‘regular ironing’ movement. It worked well, the only (minor) issue is you can’t see through it. It did not interfere at all because positioning of shirt and interfacing was in place. I’m a ‘newby’ at this process; this worked for me. This is a good quality material; one sheet can be used for ironing t-shirts forever, I plan on using the other two teflon sheets to line outdoor BBQ drawer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
B
Verified Purchase
B.Nicole
Natrona Heights, US
★★★★★ 5
High Quality & a Must-Have for Any Heat Press User
Size: 10Pack 12"x16" Black
These PTFE sheets are an absolute must if you use a heat press. I use them all the time and the quality is excellent. They’re thick, durable, and truly non-stick, which makes pressing vinyl so much easier and cleaner. They protect my projects and my heat press perfectly, and they hold up well even with frequent use. I also love the size—plenty of coverage for different projects. This 10-pack is a great value for the price, especially if you’re pressing often like I am. I’ll definitely be keeping these on hand and repurchasing when needed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 24, 2026
C
Verified Purchase
Chelsea Portillo
Bozeman, US
★★★★★ 5
Must have
Size: 3Pack 16"x20" Black
These Teflon sheets are a must-have for heat press projects! They protect my designs and heat press perfectly without sticking or leaving any marks. The material feels durable, reusable, and easy to clean after multiple uses. They handle high heat really well and make crafting so much smoother and less stressful. Perfect for sublimation, HTV, and other transfer projects. Great quality and definitely worth buying for anyone who does crafting or custom apparel!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
D
Verified Purchase
Donnafaye Moss
Pawtucket, US
★★★★★ 4
They do the job
Size: 3Pack 16"x20" Black
They work well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2026

recommand products