Pay in installments of $40.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 9 - Aug 14
For Your Every Summer RSVP, with Code: SUMMER15
Description
FABP1 His Tag Protein, HumanProduct Specification Species Human Synonyms LFABP Accession P07148 Amino Acid Sequence Met1 Ile127, with N terminal 8*His MHHHHHHHHMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAG E& RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage
Product Specification
| Species | Human |
| Synonyms | LFABP |
| Accession | P07148 |
| Amino Acid Sequence | Met1-Ile127, with N-terminal 8*His MHHHHHHHHMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI |
| Expression System | E.coli |
| Molecular Weight | 16kDa (Reducing) |
| Purity | >95% by SDS-PAG E& RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris, 100mM NaCl, pH8.0 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
FABP1 (LFABP) has been initially characterised in the liver (thus its name) but is also expressed in small intestine (duodenum and jejunum). FABP1 appears to be the most promiscuous FABP as it was reported to bind a variety of small molecules in addition to fatty acids including bile acids, lysophosphatidic acid, prostaglandins, fatty acyl-CoA, bilirubin and heme. FABP1 is a PPARα target gene. While some studies suggested that FABP1 might be involved in the delivery of ligands for PPARα activation in the nucleus, FABP1-deficient mice showed normal regulation of PPARα target genes regulation. FABP1 was reported to enhance apoB-lipoprotein secretion, which would suggest involvement of this protein in the delivery of fatty acids to the ER for esterification into lipoprotein-destined TG. Hepatic fatty acid oxidation is also diminished in fasted FABP1 knockout mice, which implies deficient transport of fatty acids to the oxidative pathway. Interestingly, no accumulation of intracellular TG accompanied attenuation of fatty acid oxidation even when the mice were challenged with a high-fat diet.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.5 ★★★★★
Based on 25 reviews
Sort
Product Reviews
★★★★★ 5
Interesting
Format: Paperback
Delivered in a timely manner and product was exactly as advertised.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 28, 2025
★★★★★ 5
Amazing!
Format: Paperback, Format: Paperback
Perfect Crypto book. I’ve read 2 others and wish I bought this first!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 11, 2025
★★★★★ 5
It's actually a good book
Format: Paperback, Format: Paperback
This book is very informative and reliable. I am using it to understand figma and it's not complicated as most tutorials I have seen.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
★★★★★ 5
More than a technical guide this book is a masterclass in design leadership using Figma!
Format: Kindle
Sharma's expertise from leading design teams at major companies shines through, offering real-world insights that integrate Figma into a strong design process.
What sets this book apart is Aditi’s genuine expertise. She doesn’t just teach the mechanics of Figma—she brings the wisdom of someone who has led design teams at Amazon, JPMorgan, and Walmart, weaving in real-world insights that make the tool feel like an extension of a strong design process. The structured approach, practical exercises, and advanced techniques helped me not only sharpen my skills but also rethink how I lead design collaboration in my teams.
For design leaders aiming to elevate their Figma expertise and use it effectively at scale, this book is an essential resource, making the transition both seamless and impactful.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2025
★★★★★ 5
Practical, Engaging, and Worth Every Penny
Format: Paperback
I’ve read a few Figma books, but this one stands out because of how engaging and hands-on it is. It’s written in a way that makes you feel like you’re learning from a mentor, not just reading a manual. The exercises are practical, and the step-by-step approach makes even complex concepts easy to grasp.
I also loved the section on integrating plugins and designing responsively for multiple devices—it’s these little details that make a big difference in real-world design work.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2025