SKU: 77020620833

Human NKX6.1, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human NKX6.1, His tagProduct Specification Species Human Synonyms Homeobox protein NK 6 homolog A Accession P78426 Amino Acid Sequence Protein sequence(P78426, Met1 Pro48&Thr66 Pro120&Pro179 Arg240, with C 10*His) MLAVGAMEGTRQSAFLLSSPPLAALHSMAEMKTPLYPAAYPPLPAGPPGGSGGSTHNPGGLKPPATGGLSSLGSPPQQLSAATPHGINDILSRPSMPVASGAALPSASPGGSGGSPSAAAVAAVGRYPKPLAELPGRTPIFWPGVMQSPPWRDARLACTPHQGSILLDKDGKRKHTRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 19. 4kDa

Product Specification


Species Human
Synonyms Homeobox protein NK-6 homolog A
Accession P78426
Amino Acid Sequence

Protein sequence(P78426, Met1-Pro48&Thr66-Pro120&Pro179-Arg240, with C-10*His)
MLAVGAMEGTRQSAFLLSSPPLAALHSMAEMKTPLYPAAYPPLPAGPPGGSGGSTHNPGGLKPPATGGLSSLGSPPQQLSAATPHGINDILSRPSMPVASGAALPSASPGGSGGSPSAAAVAAVGRYPKPLAELPGRTPIFWPGVMQSPPWRDARLACTPHQGSILLDKDGKRKHTRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 19.4kDa Actual: 20-35kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
  • 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.  
  • Please avoid repeated freeze-thaw cycles. 

Background

Homeobox protein NKX6.1 is a transcription factor (TF) that plays a critical role in pancreatic β cell function and proliferation. In human pancreatic islet, NKX6.1 expression is exclusive to β cells and is undetectable in other islet cells. As a Transcription factor, NKX6.1 binds to specific A/T-rich DNA sequences in the promoter regions of a number of genes. Involved in the development of insulin-producing beta cells in the islets of Langerhans at the secondary transition. Together with NKX2-2 and IRX3 acts to restrict the generation of motor neurons to the appropriate region of the neural tube. Belongs to the class II proteins of neuronal progenitor factors, which are induced by SHH signals.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 77020620833

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Sarah L
West Palm Beach, US
★★★★★ 5
Have to fight my cats for the right to use this blanket
Color: Pink White, Size: Throw(50"x60")
Super cute and comfy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
R
Verified Purchase
Ruth
Omaha, US
★★★★★ 5
Good cover for furniture, soft and easy to wash.
Color: Khaki, Size: Throw(50"x60")
These are great for covering couches, chairs, ect. The only problem you will have is keeping them in place.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
A
Verified Purchase
Amazon Customer
Alexandria, US
★★★★★ 5
Great blanket!
Color: Black White, Size: Throw(50"x60"), Color: Black White, Size: Throw(50"x60")
I originally bought this to use in photos for my son’s race themed birthday. It looked perfect with the checkered pattern. But it ended up a favorite blanket in our house because it’s sooo soft!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 2, 2026
A
Verified Purchase
Amy G.
Massapequa, US
★★★★★ 4
Good buy for the money
This is really nice buy. It was way bigger then I thought it was gonna be. So when we did get it I was surprised. Plus it's nice and soft. Worth the money
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 16, 2025
Z
Verified Purchase
Z💓
Birmingham, US
★★★★★ 5
I love it 💕
It’s noiceee. Not too heavy but not too light. Keeps me warm but not too hot. N it’s a really good size especially for the price. It covers me head to toe. It feels rlly soft and the color is like the picture.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 28, 2025

recommand products