SKU: 78000618301

TGFBR2 Fc Chimera Protein, Human

Sale price$250.56 Regular price$278.40
Save 10%

Pay in installments of $69.60 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 9 - Aug 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TGFBR2 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2 Accession P37173 Amino Acid Sequence Thr23 Asp159, with C terminal Human IgG1 Fc

Product Specification


Species Human
Synonyms AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2
Accession P37173
Amino Acid Sequence

Thr23-Asp159, with C-terminal Human IgG1 Fc TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

55-70kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1.Biros E, et al. (2011) Meta-analysis of the association between single nucleotide polymorphisms in TGF-β receptor genes and abdominal aortic aneurysm.  Atherosclerosis. 219(1):218-23.

Background

TGFBR2 is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. It is a transmembrane protein. TGFBR2 is comprised of a C-terminal protein kinase domain and an N-terminal ectodomain. The ectodomain consists of a compact fold containing nine beta-strands and a single helix stabilized by a network of six intra strand disulfide bonds. The folding topology includes a central five-stranded antiparallel beta-sheet, eight-residues long at its centre, covered by a second layer consisting of two segments of two-stranded antiparallel beta-sheets. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and thus regulates a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and activation of TGFBR1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways.Mutations in TGFBR2 gene have been associated with Marfan syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 78000618301

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tabatha
Lowell, US
★★★★★ 5
Fits like a glove, looks like a million!
Size: Small, Color: Purple
Bought this as a gift for him and very impressed. Looks like a million dollars, fit true to size, looks tailored not cheap. Fabric is quality, stitching is done well and the pants have a nice hidden elastic extender that helps if he goes up or down a few pounds. Very impressed!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
F
Verified Purchase
Freak77Showisnormal
Carnegie, US
★★★★★ 5
It was the perfect suit for our big day!
Size: X-Small, Color: Purple, Size: X-Small, Color: Purple
Purple size xs. He's 5'9" 145-150lbs. Very impressed with this suit. The color and pattern is awesome. The fit was good. I would say this suit runs large. Usually he wears a Medium in everything but ordered an XS and it fit very well. The pants were long we had to get those hemmed. There was a few stray strings by the end of the night in areas of the suit. But overall good quality. And for a great price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 13, 2025
M
Verified Purchase
Mabel D.
Lexington, US
★★★★★ 3
We were excited and I wanted to like it but...
Size: X-Small, Color: Black, Size: X-Small, Color: Black
We ordered this for Prom and it was supposed to be a size small, which was available for Prime ordering, but had to settle for xsmall. The pants, fortunately fit well and just need to be hemmed, the vest is great and the jacket is snug. My son has broad shoulders and I was hesitant to buy the xsmall, but it does fit just right. The only thing he would need to do is unbutton the jacket while he is dancing and maybe take it off while seated and eating dinner before prom. The material is surprisingly nice and has weight to it. I was relieved it isn't flimsy. The overall look on my son is smooth and we love the pattern and the material has shine to it. I was not happy that right out of the package, the button to the jacket could potentially fall off during because it doesn't look securely sewed in. The side of the right side of the jacket has thread already coming apart. And I found a little snag in a different location. I'm really not happy about that. I posted photos so you can see what I mean. We were excited about this suit, but it's going back. The company needs to do better with quality control.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2023
J
Verified Purchase
Jarrett
Carnegie, US
★★★★★ 5
Very Nice Fit!
Size: X-Large, Color: Black
Excellent quality and perfect fit! I used thr recommended size chart and it was just right. The design pattern in the suit gives it a very nice look. I'd order from Kudoro again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 18, 2026
L
Verified Purchase
Lis George
Boise, US
★★★★★ 5
Very stylish & tailored fit
Size: Small, Color: Pink
My husband purchased this suit as a “flower-bro” at my sister’s wedding. Unfortunately the color theme for the wedding was changed so he had to change it out which I was sad about because it fit him very well and looked great! The quality was good and the fit looked tailored.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 7, 2026

recommand products