Pay in installments of $25.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 9 - Aug 14
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Mouse CD62L, his tagProduct Specification Species Mouse Synonyms CD62 antigen like family member L, Leukocyte adhesion molecule 1 (LAM 1), Leukocyte endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, Lymphocyte antigen 22 (Ly 22), Lymphocyte surface MEL 14 antigen, Lnhr, Ly 22, Ly22 Accession P18337 Amino Acid Sequence Protein sequence (P18337, Trp39 Asn332, with C 10*His)
Product Specification
| Species | Mouse |
| Synonyms | CD62 antigen-like family member L, Leukocyte adhesion molecule 1 (LAM-1), Leukocyte-endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, Lymphocyte antigen 22 (Ly-22), Lymphocyte surface MEL-14 antigen, Lnhr, Ly-22, Ly22 |
| Accession | P18337 |
| Amino Acid Sequence | Protein sequence (P18337, Trp39-Asn332, with C-10*His) WTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYNGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 34.8 kDa Observed MW: 50-60 kDa |
| Purity | ＞95% by SDS-PAGE |
| Tag | with C-10*His |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
L-selectin, also known as CD62L, is a cell adhesion molecule found on the cell surface of leukocytes, and the blastocyst. It is coded for in the human by the SELL gene. L-selectin belongs to the selectin family of proteins, which recognize sialylated carbohydrate groups containing a Sialyl LewisX (sLeX) determinant. L-selectin plays an important role in both the innate and adaptive immune responses by facilitating leukocyte-endothelial cell adhesion events. L-selectin is also expressed by lymphoid primed hematopoietic stem cells and may participate in the migration of these stem cells to the primary lymphoid organs. In addition to its function in the immune response, L-selectin is expressed on embryonic cells and facilitates the attachment of the blastocyst to the endometrial endothelium during human embryo implantation.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy