SKU: 79367849

S100B Protein, Human

Sale price$178.20 Regular price$198.00
Save 10%

Pay in installments of $49.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

S100B Protein, HumanProduct Specification Species Human Accession P04271 Amino Acid Sequence Ser2 Glu92, with N terminal 8*His MHHHHHHHHSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE Expression System E. coli Molecular Weight 11 12 kDa(Reducing) Purity 95% by SDS PAGE Endotoxin <2EU g Conjugation Unconjugated Tag No Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4 Reconstitution Reconstitute at less than 1

Product Specification


Species Human
Accession P04271
Amino Acid Sequence

Ser2-Glu92, with N-terminal 8*His MHHHHHHHHSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Expression System E.coli
Molecular Weight

11-12 kDa(Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <2EU/μg
Conjugation Unconjugated
Tag No Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Background

S100B is a small calcium-binding protein in the neuronal system, and belongs to the S100 family. S100B proteins are a family of 25 homologous intracellular calcium-binding proteins characterized by EF hand motifs, low molecular weights (9–13 kDa), ability to form homodimers, heterodimers and oligomeric assemblies, and are characterized by tissue and cell-specific expression.  They are solely present in vertebrates. S100B protein is mainly expressed in the neuronal system such as astrocytes, maturing oligodendrocytes, dendritic cells, and Schwann cells. However, some other cells outside the brain, like kidney epithelial cells, ependymocytes, chondrocytes, adipocytes, and melanocytes, can also express S100B protein.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 79367849

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Sophia G
Dallas, US
★★★★★ 5
finally organized all my jewerly!
Color: Black
This jewelry box completely transformed the way I store and access my accessories. It’s not just functional, it’s genuinely beautiful, with a sleek design that looks great on my dresser. The exterior feels sturdy and well-made, and the interior is soft and luxurious, keeping all my pieces protected and tangle-free. There’s a perfect place for everything: rings, earrings, necklaces, and even watches or bracelets. I especially love the multiple compartments and drawers, which make it easy to separate everyday items from special pieces. No more digging around or untangling chains! The mirror inside is a thoughtful touch, and the box itself feels compact enough for smaller spaces while still holding a surprising amount. It’s one of those things that makes daily routines feel a little more put-together. If you’re looking for a jewelry box that’s practical, elegant, and gift-worthy, this one checks every box. Great for personal use or as a thoughtful present.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 1, 2025
R
Verified Purchase
readingisnotenough
Bozeman, US
★★★★★ 5
Small jewelry box bit potential
Color: Black
Very stable product perfect to have on dresser or travel. Keeps all of my items organized
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026
H
Verified Purchase
H C
Whiting, US
★★★★★ 5
Prefect Travel Case
Color: Black, Color: Black
I got this for taking my jewelry on the go. I have to say that I was pleasantly surprised by the quality it feels very sturdy. It has several spots to hold jewelry and keep it organized. The outside is textured and it closes with a snap which can be done easily.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
T
Verified Purchase
TopConsumer
Cuba, US
★★★★★ 4
Small, bu holds a lot
Color: Black
I initially purchased the Jewelry Box Necklace Ring Storage Organizer as a gift for my 8-year-old daughter. The compact design and practical features seemed perfect for her little trinkets. However, its quality and style so took me upon receiving it, I decided to keep it for myself! The jewelry box is small, but it holds a lot with a double-layer structure that provides ample storage space for various types of jewelry. It easily accommodates rings, necklaces, and other small accessories without clutter. One of the highlights of this product is its portability. Its compact size makes it an ideal travel companion. I've taken it on several trips, and it has proven incredibly convenient. It keeps all my jewelry neatly organized and easy to find, eliminating the hassle of untangling necklaces or searching for a matching earring.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 1, 2023
I
Verified Purchase
I didn’t receive the item and I let Amazon know the item was not delivered. Apparently, they don’t care to follow up with my lost order. Hummm, I wonder how the owner of Amazon would solve this problem.
Boise, US
★★★★★ 5
Small but nice
Color: green
Cute small jewelry box—
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026

recommand products