SKU: 80611165140

Human Factor H/CFH (860-1231aa) Protein, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 18 - Aug 23

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Factor H/CFH (860-1231aa) Protein, His TagProduct Specification Species Human Synonyms Complement factor H, H factor 1, HF, HF1, HF2 Accession P08603 Amino Acid Sequence Protein sequence (P08603, Ser860 Arg1231, with C His Tag)

Product Specification


Species Human
Synonyms Complement factor H, H factor 1, HF, HF1, HF2
Accession P08603
Amino Acid Sequence

Protein sequence (P08603, Ser860-Arg1231, with C-His Tag) SIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR

Expression System HEK293
Molecular Weight Predicted MW: 43.4 kDa Observed MW: 55-70 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Complement Factor H (CFH) is a critical regulatory glycoprotein of the innate immune system's complement cascade, specifically the alternative pathway. Produced primarily in the liver, it circulates in the blood and is also synthesized locally by various cell types, including retinal pigment epithelial cells. Its essential function is to protect host tissues from inappropriate complement-mediated attack. CFH acts as a cofactor for the inactivation of C3b, accelerates the decay of the C3 convertase enzyme complex, and binds to host cell surfaces. This binding is crucial for distinguishing "self" from "non-self," preventing damage to healthy human cells. Dysregulation or deficiency of CFH is strongly linked to several diseases, most notably age-related macular degeneration (AMD) and atypical hemolytic uremic syndrome (aHUS).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 80611165140

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
I
Verified Purchase
Iwona
Lake Worth, US
★★★★★ 5
Great product
UPDATE: Amazing customer service. I didn’t reach out, they did. After some adjustment shaking is minimal. Also regardless the charging. Well apparently my case is not compatible with fast charge. Phone charges fast without the case. Guess that has been my issue with other wireless charges. Definitely recommend. My husband went with another brand and now will be getting the same as mine. Cool idea but definitely not super fast charge. In 40 minutes charged only 10%, was expecting more. Hold phone well but it shakes while driving. Installation was super easy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 31, 2025
E
Verified Purchase
Emal Amirshah
Cuba, US
★★★★★ 1
.
Don’t waste your money on this phone holder. I had a very bad experience with it, and it damaged my phone twice. The holder opens by itself without warning, causing the phone to fall out while driving. Sometimes I found my phone under the seats, and other times it dropped while I was driving on the highway, which is very dangerous and distracting. One time, the holder suddenly released my phone and it hit the handbrake hard, breaking the screen completely. I had to spend $500 to replace the screen. The opening and locking system does not work properly. Sometimes it opens randomly, and sometimes it closes by itself. The wireless charging is also unreliable — sometimes it charges, and other times it stops charging unexpectedly. When the charging stops, the holder suddenly unlocks and drops the phone. Overall, this product is unsafe, unreliable, and not worth the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
P
Verified Purchase
PDD
Natrona Heights, US
★★★★★ 5
Outstanding! 5 Stars for Mobility, Durability, Functionality and Ease of Use.
This little invention is outstanding! It holds phones of multiple sizes very securely in place without any bonding or sticky attachments that could damage your vehicle. Mobility is simple as it's easy to add and remove to any vehicle with air condition vents. Best of all, various size devices can be easily held in place with a quick squeeze of the side mounts and just as easily removable with a single press of a release button on the back side. The mount is also very strong and holds up to various temperatures. For example, in the summer it can become very hot in an enclosed vehicle and this mount holds up when other mounts tend to fail from over exposure to heat. The failure causes the joints or fittings to loosen, which will cause your device to slip from an intended position. Well, that is not a problem with this one. It has stood the test of time as I have used this mount for over a year in extreme environments. In the end, it appears that my family has come to like this product too. Ahem, my wife just took mine! So, I have returned to purchase another one for myself and two more for my daughters. Then I don't have to worry about my daughters taking mine either. Yes, I'm finally thinking ahead, so maybe you should think ahead and get additional copies for your family members. Either way, try one and you'll likely be back for more. It makes a great gift. I highly suggest this product to everyone who needs a mobile device mount for their vehicle.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 4, 2025
S
Verified Purchase
sicario
Lake Worth, US
★★★★★ 5
Excellent Product and Exceptional Quality and Service – Highly Recommend!
I recently purchased the LISEN Car Phone Holder Mount [Military Stable] and couldn’t be more impressed! From the moment I unboxed it, I could tell it was built to last. The design is sleek and modern, and it holds my iPhone 15 Pro Max securely without any wobbling, even during bumpy rides. The military-grade stability lives up to its promise—this mount stays firmly in place, and the adjustable clamps fit my phone perfectly. What really stood out to me was the ease of installation. It attaches to my car vent effortlessly, with no tools required, and doesn’t block any air flow, which is a huge plus. It’s also compatible with various phone models, including the latest iPhone 16, so I know it will be a long-term solution for my future upgrades. In addition to the great product, the customer service from Linsen was outstanding. They provided timely and clear communication, answering all my questions before I made the purchase. It’s rare to experience such excellent support these days, and it made my buying experience even better. If you’re looking for a reliable, sturdy, and easy-to-use car phone holder, this is the one to get! https://www.amazon.com/dp/B0CXLQDY5B Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 10, 2024
O
Verified Purchase
OBSSD
Lexington, US
★★★★★ 4
Well made, but not a good fit for Volvo XC40
One issue with this style of holder, is that the swing arm and holder add a fair amount of weight and extends that weight away from the vent, applying quite a bit more leverage on the vent. It may not be as much of an issue on horizontal vents, but the vertical vents on an XC40 will want to swing side-to-side with all that weight. As for the build of this particular holder, my only real gripe is the adjustment for the swing arm - after tightening the knob, there will still be some play in the arm...you have to jiggle it while tightening it down to fully secure it. The position of the release button allows one-handed removal of the phone, but really only works by pinching with your thumb on the screen. The clip for the vent accommodates relatively wide fins and the tabs can be rotated to help with stability or removed to provide more clearance (though rubberized tabs would be much more helpful).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2024

recommand products