Pay in installments of $45.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 13 - Aug 18
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
USP11 ProteinProduct Specification Species Human Antigen USP11 Synonyms HX1,Deubiquitinating enzyme 11, Ubiquitin carboxyl terminal hydrolase 11,Ubiquitin specific peptidase 11,Ubiquitin specific protease 11 Accession P51784 Amino Acid Sequence Asp67 Glu300, with N terminal 8*His
Product Specification
| Species | Human |
| Antigen | USP11 |
| Synonyms | HX1,Deubiquitinating enzyme 11, Ubiquitin carboxyl-terminal hydrolase 11,Ubiquitin specific peptidase 11,Ubiquitin specific protease 11 |
| Accession | P51784 |
| Amino Acid Sequence | Asp67-Glu300, with N-terminal 8*His HHHHHHHHDREPQHEELPGLDSQWRQIENGESGRERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIERKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFSHTDSIGLVLRTARERFLVEPQEDTRLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQLHVMNNNMSEEDE |
| Expression System | E.coli |
| Molecular Weight | 28kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE&HPLC |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles. |
| Reference | 1. Haruko Ideguchi, et al. (2002) C Structural and functional characterization of the USP11 deubiquitinating enzyme, which interacts with the RanGTP-associated protein RanBPM. Biochem J. 1;367(Pt 1):87-95. |
Background
USP11 is also named as UHX1 and belongs to the peptidase C19 family. It is a deubiquitinating enzyme that controls many intracellular processes, including cell cycle progression, transcriptional activation, and signal transduction. USP11 as a novel regulator of Mgl-1 and it requires RanBPM to regulate proteasomal degradation of Mgl-1. USP11 showed deubiquitinating activity and stabilized Mgl-1 protein. However, USP11-mediated Mgl-1 stabilization was inhibited in RanBPM-knockdown cells. Furthermore, in the cancer cell migration, the regulation of Mgl-1 by USP11 required RanBPM expression. In addition, an in vivo study revealed that depletion of USP11 leads to tumor formation. Taken together, the results indicated that USP11 functions as a tumor suppressor through the regulation of Mgl-1 protein degradation via RanBPM. USP11 may be a ubiquitous protein in various human tissues. By immunofluorescence assay, USP11 primarily was localized in the nucleus of non-dividing cells, suggesting an association between USP11 and RanBPM in the nucleus. Furthermore, the association between USP11 and RanBPM in vivo was confirmed not only by yeast two-hybrid assay but also by co-immunoprecipitation assays using exogenously expressed USP11 and RanBPM.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy