Pay in installments of $69.62 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 17 - Aug 22
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
GITR/TNFRSF18 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms CD357 antigen, CD357, GITR, GITR D, GITRtumor necrosis factor receptor superfamily member 18, Glucocorticoid induced TNFR related protein, TNFRSF18, tumor necrosis factor receptor superfamily, member 18 Accession Q9Y5U5 1 Amino Acid Sequence Gln26 Glu161, with C terminal Human IgG Fc
Product Specification
| Species | Human |
| Synonyms | CD357 antigen, CD357, GITR, GITR-D, GITRtumor necrosis factor receptor superfamily member 18, Glucocorticoid-induced TNFR-related protein, TNFRSF18, tumor necrosis factor receptor superfamily, member 18 |
| Accession | Q9Y5U5-1 |
| Amino Acid Sequence | Gln26-Glu161, with C-terminal Human IgG Fc QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Expression System | HEK293 |
| Molecular Weight | 40-50kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | Human Fc |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1,Nature
Communications volume 12, Article number: 1378 (2021) Cite this article 5809 Accesses
9 Citations 1 Altmetric Metrics. |
Background
GITR(Glucocorticoid-induced Tumor necrosis factor Receptor), also known as AITR and TNFRSF18, is a 40 kDa transmembrane glycoprotein belonging to the tumor necrosis factor receptor (TNF-R) superfamily. Mature human GITR consists of a 137 amino acid (aa) extracellular domain (ECD) with three tandem TNFR cysteine-rich repeats, a 21 aa transmembrane segment, and a 58 aa cytoplasmic domain. GITR is expressed on CD4+CD25+ regulatory T cells (Treg) as well as on subsets of thymocytes, lymph node cells, and splenocytes. GITR plays a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+) regulatory T cells.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy