SKU: 82495918127

Mouse Olfactory Marker Protein, His Tag

Sale price$99.00 Regular price$110.00
Save 10%

Pay in installments of $27.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse Olfactory Marker Protein, His TagProduct Specification Species Mouse Synonyms Omp Accession Q64288 Amino Acid Sequence Protein sequence (Q64288, Ala2 Leu163, with C His Tag) AEDGPQKQQLEMPLVLDQDLTQQMRLRVESLKQRGEKKQDGEKLIRPAESVYRLDFIQQQKLQFDHWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPAAIFWRKEDSDAMDWNEADALEFGERLSDLAKIRKVMYFLITFGEGVEPANLKASVVFNQL Expression System E. coli Molecular Weight Predicted MW: 20. 6 kDa Observed MW: 20. 6 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation

Product Specification


Species Mouse
Synonyms Omp
Accession Q64288
Amino Acid Sequence

Protein sequence (Q64288, Ala2-Leu163, with C-His Tag) AEDGPQKQQLEMPLVLDQDLTQQMRLRVESLKQRGEKKQDGEKLIRPAESVYRLDFIQQQKLQFDHWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPAAIFWRKEDSDAMDWNEADALEFGERLSDLAKIRKVMYFLITFGEGVEPANLKASVVFNQL

Expression System E.coli
Molecular Weight Predicted MW: 20.6 kDa Observed MW: 20.6 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Olfactory Marker Protein (OMP) is a small, cytoplasmic protein highly and selectively expressed in mature olfactory sensory neurons of most vertebrates. First identified in 1975, it serves as a canonical marker for fully differentiated, functional olfactory neurons. Although not directly involved in odorant binding or signal initiation, OMP plays a crucial modulatory role in olfactory signal transduction. It accelerates signal kinetics and contributes to the precise temporal patterning of neuronal responses. Knockout studies demonstrate that its absence leads to attenuated electrical signals and impairments in odor discrimination. Thus, OMP is essential for the high sensitivity and rapid signaling characteristic of the mammalian olfactory system.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 82495918127

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Platinum Motif
Battle Creek, US
★★★★★ 5
This was the best
Size: 1 Panel
This divider is great for creating a little privacy or separating a small area without taking up much space. The fabric is thick enough to block visual clutter, and the frame is lightweight but stable once it’s opened. It folds flat for storage, which is convenient if you only need it occasionally. Assembly was straightforward, and it was the perfect size. It’s a practical piece for apartments, studios, or home offices where you want a quick, temporary partition.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
J
John M.
Louisville, US
★★★★★ 5
Good privacy screen
Size: 1 Panel, Size: 1 Panel
This is a good privacy screen that's easy to assemble and looks nice. Be a little careful moving it, as the corners can twist. It's sturdy once in place, and the thick material is completely opaque. If the folds bother you, you might want to iron it, but I'm happy with it as is.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026
D
Dan & Stacey
Houston, US
★★★★★ 3
Lightweight divider that works well for video call backgrounds
Size: 1 Panel
This divider works fine for what it is, but it’s definitely on the lightweight side. Setup was very easy and only took a few minutes. The frame is fairly light, so it’s easy to move around or reposition if needed. That said, the tradeoff is that it’s not especially sturdy. It stands fine on its own but I wouldn’t expect it to handle much bumping or movement. I mainly bought it to use as a background for Zoom calls when I’m working from my den, and for that purpose it works great. The fabric panel blocks the room behind me and gives a cleaner background on camera. It’s not huge though. To keep the camera from seeing around it, I have to position it directly behind my chair. If you’re expecting it to divide a large room or create a big privacy barrier, it may feel a bit small. Overall, it does the job and works well for temporary setups or video call backgrounds, but the lightweight frame keeps it from feeling like a premium divider. The product description and photos are accurate.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2026
C
Customer Review
Belleville, US
★★★★★ 2
Sent Wrong Pieces
Size: 1 Panel, Size: 1 Panel
I really, really wanted to like this - and, in theory, I really, really should have! The instructions were easy to follow and assembly took about five minutes. The assembled screen is lightweight and easy to move. It was a great size and exactly what I was looking for except....I wasn't sent the correct pieces. Instead of receiving 4 elbow pieces and 4 feet, I received 2 elbow pieces and 8 feet - meaning that the bottom part of the fabric just hangs there and, overall, the divider is extremely unstable because there is no horizontal support on the bottom. Thankfully, there are Velcro tabs on the side of the fabric so I can use it if I don't plan to move it even 1 cm, but otherwise, what I received is not usable for what I needed it for. Additionally, the fabric is made of polyester and catches animal hair very easily. Had I received the correct pieces, this would be a good buy for the money. Unfortunately, overall, I'm disappointed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 28, 2026
K
Kenneth
Los Angeles, US
★★★★★ 5
Works great, keeps the light out of my eyes and easy to put together
Size: 1 Panel, Size: 1 Panel
I got this room divider in and it works great. It’s really easy to put together you don’t even need tools. I really like that it’s not see through, it’s not a black out curtain but it keeps light out pretty good. I absolutely hate my bedroom layout there’s no bathroom door. My girlfriend and I have different work schedules so I’m trying to sleep while she’s getting ready for work and the light shines right in my eyes. This divider keeps the light out of my eyes and that’s exactly what I was hunting for. I also like that you can adjust the length. I took one of the bars out to make it a little shorter and it worked great. I would recommend this room divider.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 26, 2026

recommand products