SKU: 82599083930

Human NKX2.2, His tag

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 12 - Aug 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human NKX2.2, His tagProduct Specification Species Human Synonyms Homeobox protein NK 2 homolog B, NKX2. 2, NKX2B Accession O95096 Amino Acid Sequence Protein sequence (O95096, Met1 Lys127, with C 10*His) MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 14. 9 kDa Observed MW: 20 33 kDa Purity 95% by SDS PAGE Tag with C

Product Specification


Species Human
Synonyms Homeobox protein NK-2 homolog B, NKX2.2, NKX2B
Accession O95096
Amino Acid Sequence

Protein sequence (O95096, Met1-Lys127, with C-10*His) MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 14.9 kDa Observed MW: 20-33 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Homeobox protein Nkx-2.2 is a protein that in humans is encoded by the NKX2-2 gene. Homeobox protein Nkx-2.2 contains a homeobox domain and may be involved in the morphogenesis of the central nervous system. This gene is found on chromosome 20 near NKX2-4, and these two genes appear to be duplicated on chromosome 14 in the form of TITF1 and NKX2-8. The encoded protein is likely to be a nuclear transcription factor. The expression of Nkx2-2 is regulated by an antisense RNA called Nkx2-2as. In the developing spinal cord, Nkx-2.2 regulates IRX3 thereby contributing to the proper differentiation of the ventral horn neurons.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 82599083930

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
H
Verified Purchase
HEATHER
Belleville, US
★★★★★ 4
Durable
Color: E) 8-Pack 2.5" Balls (Yellow)
My dogs love them. They are very bouncy, and ideal size, and durable. Great alternative to a tennis ball which in my house only last 30 minutes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 23, 2026
K
Verified Purchase
Kindle Customer
Phoenix, US
★★★★★ 5
Toughest dang balls I ever played with
Color: D) 4-Pack 3" Balls (Yellow), Color: D) 4-Pack 3" Balls (Yellow)
These things are amazing. We have a ball obsessed Husky mix and he has destroyed Kongs, Chuck Its, and a whole lot of other ball shaped objects. These things? We bought the 4 pack because we bought 4 Chuck Its and they lasted a year, all 4 of them only a year, before they were destroyed. A year after buying these? We only bought more because he lost 3 of them. I think we did find one under the dresser after buying this pack... But the others? They either ended up thrown over the fence into the woods or lost in the holes in the yard the monster digs up. Other than a few pockmarks from his teeth and maybe some mud, they may as well be brand new even after a year or two. Probably the most chew resistant thing we've ever bought him. They're really solid rubber and since he hasn't managed to bite into them to take out a chunk, they're safe as hell. Being as big as they are, I don't worry he's gonna choke unattended on them like the usual size of ball. About the only concern is forcing breaks so he can have breathing moments when he manages to talk us into fetch outside. It fits in the larger Chuck It thrower too, so we haven't lost any value from having those torn up.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
K
Verified Purchase
Katy Beems
Belleville, US
★★★★★ 5
Sturdy bouncy fun!
Color: D) 4-Pack 3" Balls (Yellow), Color: D) 4-Pack 3" Balls (Yellow)
Great product. My big 70lb Sheppard puppy loves it, hasn’t stopped playing with it since it arrived. She throws it about and chases it, had a good chew on it and even put it in her favorite toys bin. Sturdy, firm and very bouncy. And there are 3 more in the bag for an awesome price. Bright color will make it easy to find and holes thru it will prevent choking and I can string it on a line for training play.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 28, 2025
R
Verified Purchase
Rhonda T Hills
Fort Morgan, US
★★★★★ 5
Dogs love these
Color: C) 2-Pack 2.5" Balls (Yellow)
Great quality balls for tough chewers. I love them, but wish the orange ones were available more...I've been checking cuz they are easier to find in the yard than the green that blends in. Our dogs love them and I like the weight for throwing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
T
Verified Purchase
Tracy C.
Omaha, US
★★★★★ 5
The perfect toy for dogs!
Style: The Duo
This is perfect when you have 2 dogs who love to play Fetch! They no longer have to chase after the same ball! The balls that come with it are very sturdy, and the launcher sends both balls far enough away so that both dogs get plenty of exercise. It’s definitely worth the price!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026

recommand products