SKU: 82624162124

Human Angiotensin Converting Enzyme 1 Protein, His tag

Sale price$112.50 Regular price$125.00
Save 10%

Pay in installments of $31.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Angiotensin Converting Enzyme 1 Protein, His tagProduct Specification Species Human Synonyms Angiotensin converting enzyme, ACE, Dipeptidyl carboxypeptidase I, Kininase II, CD143, DCP, DCP1 Accession P12821 Amino Acid Sequence Protein sequence (P12821, Pro631 Arg1232, with C His tag)

Product Specification


Species Human
Synonyms Angiotensin-converting enzyme, ACE, Dipeptidyl carboxypeptidase I, Kininase II, CD143, DCP, DCP1
Accession P12821
Amino Acid Sequence

Protein sequence (P12821, Pro631-Arg1232, with C-His tag) PLPDNYPEGIDLVTDEAEASKFVEEYDRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPNGSCLQLEPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNSAR

Expression System HEK293
Molecular Weight Predicted MW: 71.1 kDa Observed MW: 95 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Angiotensin - converting enzyme (ACE) is a crucial enzyme in the body's renin - angiotensin - aldosterone system (RAAS). It plays a key role in regulating blood pressure and fluid balance. ACE is mainly found in the lungs, but is also present in other tissues. Functionally, ACE converts angiotensin I into angiotensin II, a powerful vasoconstrictor. Angiotensin II causes blood vessels to narrow, increasing peripheral resistance and thus raising blood pressure. Additionally, it stimulates the release of aldosterone from the adrenal glands, which promotes sodium and water reabsorption in the kidneys, further contributing to blood volume and pressure regulation. Dysregulation of ACE activity can lead to hypertension and other cardiovascular disorders, making it an important target for drugs like ACE inhibitors in treating such conditions.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 82624162124

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tom B
Grantham, US
★★★★★ 5
Inkjets have come a long way
Pattern Name: Printer, Style: ET-15000
Just a lot to like about this printer and nothing I don't like. Very capable for the price. I do mostly black and white printing, rarely print photos. (This will supposedly do a credible job of photo printing too but I haven't tried it). If you want professional caliber photo printing, you probably want the Epson 8550 which is similar to this, a bit more expensive, but does 6 color printing. If you are doing more like every day business printing the 15000 might be a better choice because it's built more for speed. The tank system means I can just replace the black because I use it a lot. The black ink tank is double size of the others and based on my experience so far, I think I'll easily get over a thousand pages on the standard-vivid setting which is very strong black but still relatively high speed printing. Given that the black ink bottles are under $30 I think the cost per page will be comparable to laser. The booklet/pamphlet printing can be complicated to work out with layers of PDF software and the Epson printer driver. But once you work it through, it's super capable. I've printed a lot of 12 x 18 double-sided for booklets and the paper handling has been flawless. (It can duplex automatically for 8 1/2 x 11 but for other sizes you have to manually duplex, which you can do by printing back/front or even/odd.) It's not as fast as a laser printer but it's pretty fast -- inkjets have improved so much.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 16, 2026
L
Verified Purchase
Loleta Harlan
Bozeman, US
★★★★★ 5
Perfect Printer for My Small Business
Pattern Name: Printer, Style: ET-15000
I purchased the Epson ET-15000 for my crafting and apparel business and have been very pleased with its performance. The print quality is excellent, colors are vibrant, and the large ink tanks help save money over time. It handles larger print sizes with ease and has become an essential part of my workspace.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
W
Verified Purchase
wwise
Chelsea, US
★★★★★ 5
Nice large format printer which is what I needed
Pattern Name: Printer, Style: ET-15000
I make stained glass panels and needed a printer that I could make larger copies with. I also wanted one that I could manipulate my images with. This was my best option and I love the Eco-Tank printers. After reading the reviews I made sure to add a couple years of additional warranty for my peace of mind. Finding 13 x 19 paper that was affordable was a tough challenge. I found a bunch on FB marketplace and bought everything they had to offer. This printer was very easy to set-up. I just followed the instructions and then followed what was on my computer screen. At first I thought I would have an issue connecting to Wi-Fi but when it failed on the computer, I was able to go to the printer and do it from the control panel - Easy peesey. I have used it several times since filling, charging, and installing and everything works as it should. My husband has an Eco-Tank printer and I've wanted one since he got his. I love that the ink will last a very long time and that it will be cost efficient. I am not overly interested in photo printing so this was the perfect choice for my needs. The print quality is fairly good when comparing it to my old Canon and e that there are several paper trays and ways to make copies, especially the automatic feed and the larger scanner bed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 26, 2026
J
Verified Purchase
JC
Waukegan, US
★★★★★ 1
document feeder not working on first real use.
Pattern Name: Printer, Style: ET-15000
Serious reliability issues and concerns. We have owned the printer for about 1 month and printed a limited amount. For the first time today I tried scanning with the document feeder. I was scanning about 12 pages that should of been 1 document. The first page scanned and then stopped. I started the scanner again and it scanned about 5 pages and then jammed. The rest of the pages were a constant jamming/not feeding fiasco. I would run to the computer and hit scan, then run to the printer and manually push on the paper as hard as i could without the paper bending. if I pushed just right i could get a few pages through without jamming. I ended up with about 6 pdf's instead of one document and constant jamming in the paper feeder. Frustrating from a brand new printer and the first time using the paper scanner. There is a clicking noise when it scans. a few of the pages fed properly but the rest had to be forced. No obvious obstructions or other issues. I tried cleaning the rollers with no success. Then attempted to reach out to Epson support. The only support option I could find was an email form that put me in a captia loop after entering all the information so I had to start over on the ticket submission. No chat support, no phone number, brand new higher priced printer with serious build/reliability issues. Frustrating.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
C
Verified Purchase
Cassandra Jackson-Valentine
Belleville, US
★★★★★ 5
This is a great printer. I love it.
Pattern Name: Printer, Style: ET-15000
I’ve been using the Epson ET‑15000 for custom chip bags and ran into a huge issue with my original paper choice. The printer itself is great, but the Koala 30 lb glossy paper did not play well with the black ink at all. Even after letting my prints sit for a full two days, the black areas would still smear and come off on my fingers as soon as I started folding and assembling the bags. It was super frustrating and made it hard to trust my prints for orders. I decided to try Eshang high gloss paper instead, and the difference has been night and day. With the same Epson ET‑15000 and the same designs, the Eshang paper works like a charm. The black ink dries quickly, doesn’t rub off when handled, and holds up beautifully while I’m folding and sealing my chip bags. Colors look vibrant, the finish is nice and glossy, and I don’t have to worry about smudging anymore. If you’re using an Epson EcoTank like the ET‑15000 and struggling with black ink smearing on Koala glossy, I highly recommend switching to Eshang high gloss. It completely solved the problem for me and made my chip bag printing so much easier and more professional.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 13, 2026

recommand products