Pay in installments of $25.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 14 - Aug 19
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human GZMB , His tagProduct Specification Species Human Synonyms C11, CTLA 1, Cathepsin G like 1 (CTSGL1), Cytotoxic T lymphocyte proteinase 2 (Lymphocyte protease), Fragmentin 2, Granzyme 2, Human lymphocyte protein (HLP), SECT, T cell serine protease 1 3E, CGL1, CSPB, GRB Accession P10144 Amino Acid Sequence Protein sequence(P10144, Gly19 Tyr247, with C 10*His)
Product Specification
| Species | Human |
| Synonyms | C11, CTLA-1, Cathepsin G-like 1 (CTSGL1), Cytotoxic T-lymphocyte proteinase 2 (Lymphocyte protease), Fragmentin-2, Granzyme-2, Human lymphocyte protein (HLP), SECT, T-cell serine protease 1-3E, CGL1, CSPB, GRB |
| Accession | P10144 |
| Amino Acid Sequence | Protein sequence(P10144, Gly19-Tyr247, with C-10*His) GEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRYGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:27.4kDa Actual:33kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Granzyme B (GZMB) is one of the serine protease granzymes most commonly found in the granules of natural killer cells (NK cells) and cytotoxic T cells. It is secreted by these cells along with the pore forming protein perforin to mediate apoptosis in target cells.Granzyme B has also been found to be produced by a wide range of non-cytotoxic cells ranging from basophils and mast cells to smooth muscle cells. The secondary functions of granzyme B are also numerous. Granzyme B has shown to be involved in inducing inflammation by stimulating cytokine release and is also involved in extracellular matrix remodelling.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.8 ★★★★★
Based on 8 reviews
Sort
Product Reviews
★★★★★ 5
Good tire kit
Just what I needed for the sxs
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
★★★★★ 4
Good little pump
Works better than expected.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
★★★★★ 5
Should have bought this years ago!!!
I live at the end of 25 minutes dirt road top of red Mountain, Co. On the 3rd flat in 2 weeks I ordered this kit instead of putting a spare on and driving to town 1 hour away. and knock on wood its has held going on 3 weeks. I jacked up the car, followed the instruction and wow easier then going to Big-O. Love it and told my Kids they need to get it also.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
★★★★★ 5
A Must-Have Emergency Kit for Every Vehicle, Especially ATVs!
I recently bought this 54PCS Flat Tire Repair Kit with Air Compressor, and I’m seriously impressed. It’s one of those products you hope you won’t need—but are SO glad to have when the time comes. I used it on my ATV after catching a sharp rock on the trail, and it saved the day. The plug worked perfectly, and the air compressor had my tire reinflated in just a few minutes.
What I really love is how complete the kit is. From cars and motorcycles to trucks and tractors, it’s got everything you need to handle a flat. The tools are solid and durable, and the case keeps everything neatly organized. It’s compact enough to toss in the back of my truck or ATV storage box without taking up too much space.
If you ride ATVs in remote areas like I do, this kit is a no-brainer. It gives you peace of mind and saves you from having to hike back to civilization. Highly recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2025
★★★★★ 5
Kept it in my trunk for months — used it once and it saved me
I’ve had this AUTOWN tire repair kit sitting in the trunk for several months as a “just in case” thing. I have only had to use it once, but the tools and compressor held up and it actually helped me get out of a bad spot where I didn’t have a spare tire available.
Just to be clear, I wouldn’t call this a permanent fix. It’s more of an emergency repair to get you back on the road. In my case it did exactly that. Afterward, I went to a nearby tire shop and had the tire repaired the right way.
Overall, I’m really glad I had it in the car. Just using it once has already paid for itself.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2026