Pay in installments of $48.75 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 13 - Aug 18
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human LECT2, His tagProduct Specification Species Human Synonyms Leukocyte cell derived chemotaxin 2, LECT 2, hLECT2 Accession O14960 Amino Acid Sequence Protein sequence (O14960, Gly19 Leu151, with C 10*His) GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPTAYLGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 16. 3 kDa Observed MW: 18 kDa Purity 95% by SDS PAGE
Product Specification
| Species | Human |
| Synonyms | Leukocyte cell-derived chemotaxin-2, LECT-2, hLECT2 |
| Accession | O14960 |
| Amino Acid Sequence | Protein sequence (O14960, Gly19-Leu151, with C-10*His) GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPTAYLGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 16.3 kDa Observed MW: 18 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Tag | with C-10*His |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
Leukocyte cell-derived chemotaxin-2 (LECT2) is a chemotactic factor for neutrophils. Subsequent studies have defined LECT2 as a hepatokine. LECT is an evolutionary conserved protein, has one or more important functions, and may be involved in various diseases. Human LECT2 is a secreted, 16 kilodalton protein. Its structure is similar to that of the M23 family of metalloendopeptidases. LECT2 has not been found to possess enzymatic activity and does not appear to share any functions with M23 metalloendopeptidases. The liver hepatocyte is considered to be the source of the LECT2 circulating in blood. Several cell types or tissues, e.g. osteoblasts, chondrocytes, cardiac tissue, gastrointestinal smooth muscle cells, and epithelial cells of some tissues normally do not express LECT2 but do so under a variety of disease conditions. LECT2 amyloidosis (ALECT2) was the common (~3% of total) cause of amyloidosis. Circulating levels of LECT2 are elevated in >90% of individuals with hepatoblastoma and >20% of individuals with Hepatocellular carcinoma. In the latter form of liver cancer, LECT2 levels increase with increasingly poor prognostic stages of the disease and therefore may prove to be valuable prognostic markers.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy