SKU: 83907733767

Human Thrombopoietin, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Thrombopoietin, His tagProduct Specification Species Human Synonyms C mpl ligand (ML), Megakaryocyte colony stimulating factor, Megakaryocyte growth and development factor (MGDF), Myeloproliferative leukemia virus oncogene ligand, THPO, MGDF Accession P40225 Amino Acid Sequence Protein sequence(P40225, Ser22 Gly353, with C 10*His)

Product Specification


Species Human
Synonyms C-mpl ligand (ML), Megakaryocyte colony-stimulating factor, Megakaryocyte growth and development factor (MGDF), Myeloproliferative leukemia virus oncogene ligand, THPO, MGDF
Accession P40225
Amino Acid Sequence

Protein sequence(P40225, Ser22-Gly353, with C-10*His) SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEGGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Theoretical:37.1kDa Actual:75-90kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months,

-20 to -70 °C under sterile conditions after reconstitution.

1 week, 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.

Background

Thrombopoietin (THPO) also known as megakaryocyte growth and development factor (MGDF) is a protein that in humans is encoded by the THPO gene. Thrombopoietin is a glycoprotein hormone produced by the liver and kidney which regulates the production of platelets. It stimulates the production and differentiation of megakaryocytes, the bone marrow cells that bud off large numbers of platelets. Megakaryocytopoiesis is the cellular development process that leads to platelet production. Thrombopoietin is a humoral growth factor necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 83907733767

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
RW
Battle Creek, US
★★★★★ 5
Good Quality and Easy to Install and
Model: iPad A16 11th 2025 /10th 2022
This glass protector was the easiest one i have ever used. went in on easily and only a couple of bubbles that were easy to push out. It seems to be made with quality material and fits perfectly. Got the first one right so now i have a spare.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
M
Verified Purchase
M. Inglee
West Palm Beach, US
★★★★★ 5
Very nice case
Model: iPad A16 11th 2025 /10th 2022
Fits well. Very sturdy. Looks great and was easy enough for a 9 year old to install ;-)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
A
Verified Purchase
AD Burrows
New York, US
★★★★★ 5
The perfect screen protector.
Model: iPad A16 11th 2025 /10th 2022
What a great product! I’ve used this brand in the past for my iPhone & and iPads, always found them easy to install & the crystal clear HD quality is amazing. It’s easy to align & comes with two just in case you mess up otherwise you have a spare as a backup. Worth every penny.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
R
Verified Purchase
rebecca
Grantham, US
★★★★★ 5
Glass screen cut shield
Model: iPad A16 11th 2025 /10th 2022
This is a great product. I’ve used on every phone I’ve owned and now I’m using it on my tablets. Wouldn’t use anything else. Love it. Price is great and the product works great
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026
T
Verified Purchase
T'Quanda
Belleville, US
★★★★★ 4
Clear protection with easy installation
Model: iPad 9th/8th/7th Gen 10.2 Inch, Model: iPad 9th/8th/7th Gen 10.2 Inch
The ProCase screen protectors fit my iPad 7th generation well and provide clear protection without affecting touch sensitivity or screen clarity. The installation process was very simple, Unfortunately I did have some trouble with bubbles forming in the corner after applying the first one, which was a bit difficult to fully smooth out. The second protector went on slightly better, but it still required extra effort to get a perfect finish. Despite that issue, the screen protector still does its job well in protecting against scratches and daily wear. It also comes in a 2 pack, which adds good value in case one is applied incorrectly. It’s a solid product for protection, but the installation can be a little tricky if you want a completely flawless, bubble free look
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026

recommand products