Pay in installments of $60.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 12 - Aug 17
For Your Every Summer RSVP, with Code: SUMMER15
Description
ACVR2A His Tag Protein, HumanProduct Specification Species Human Antigen ACVR2A Synonyms ACVR2A, Activin receptor type IIA, ACTRIIA Accession P27037 Amino Acid Sequence Ala20 Pro134, with C terminal 8*His AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPGGGSHHHHHHHH Expression System HEK293 Molecular Weight 25 33kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance
Product Specification
| Species | Human |
| Antigen | ACVR2A |
| Synonyms | ACVR2A, Activin receptor type IIA, ACTRIIA |
| Accession | P27037 |
| Amino Acid Sequence |
Ala20-Pro134, with C-terminal 8*His AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 25-33kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage |
· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Zhou C. et al. (2018) Downregulation of Activin A Receptor Type 2A Is Associated with Metastatic Potential and Poor Prognosis of Colon Cancer. J Cancer. 9(19): 3626-3633. |
Background
ACVR2A (activin A receptor type 2A) belongs to a receptor family that mediates the functions of activins, members of the transforming growth factor-beta (TGF-β) family of ligands with multiple biological functions. The TGF-β signaling pathway is involved in the regulation of cell proliferation, differentiation, migration, and apoptosis of colon cancer. The mutation rate of ACVR2A is approximately 60%, making it the most frequently mutated gene in hypermutated colon cancer. However, the expression profiles of ACVR2A and its biological function in colon cancer tumorigenesis and progression are largely unknown.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy