SKU: 86101970480

Mouse CD95, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD95, his tagProduct Specification Species Mouse Synonyms Apo 1 antigen, Apoptosis mediating surface antigen FAS, FASLG receptor, Apt1, Tnfrsf6 Accession P25446 Amino Acid Sequence Protein sequence (P25446, Gln22 Arg169, with C 10*His) QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 18. 2 kDa

Product Specification


Species Mouse
Synonyms Apo-1 antigen, Apoptosis-mediating surface antigen FAS, FASLG receptor, Apt1, Tnfrsf6
Accession P25446
Amino Acid Sequence

Protein sequence (P25446, Gln22-Arg169, with C-10*His) QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 18.2 kDa Observed MW: 23-30 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The Fas receptor, also known as Fas, FasR, apoptosis antigen 1 (APO-1 or APT), cluster of differentiation 95 (CD95) or tumor necrosis factor receptor superfamily member 6 (TNFRSF6), is a protein that in humans is encoded by the FAS gene. Fas was first identified using a monoclonal antibody generated by immunizing mice with the FS-7 cell line. Thus, the name Fas is derived from FS-7-associated surface antigen. The Fas receptor is a death receptor on the surface of cells that leads to programmed cell death (apoptosis) if it binds its ligand, Fas ligand (FasL). It is one of two apoptosis pathways, the other being the mitochondrial pathway.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 86101970480

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Erin Gerloff
Belleville, US
★★★★★ 5
Light weight, not thick or bulky, versatile, and perfect!
Color: White, Size: Small
Throw out all the tank tops you own cause this is the only tank top you will need from here on out. It is absolutely perfect. Let’s just say they understood the assignment. It is form fitting and pairs perfectly with lightweight sweaters that might be slightly sheer or even the new crochet type of open sweaters that need a tank underneath. It is the perfect stretch, perfect material and dressy enough to be worn on its own and upgraded with some jewelry and some classy jeans and has just enough sheen to look dressy and not like you’re wearing a workout top. I love , love this and it is my go to tank!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
A
Verified Purchase
Amanda Rogers
Omaha, US
★★★★★ 5
Comfortable, flattering wardrobe staple
Color: White, Size: Small, Color: White, Size: Small
I’ve tried a lot of basics, and this ANRABESS sleeveless scoop neck tank exceeded expectations. The fabric feels soft and breathable with a nice amount of stretch, and it has a flattering fit without being too tight or restrictive. The scoop neckline is classic and versatile, making it easy to layer or wear on its own. Stitching and construction appear well made, and it held up nicely after washing with no shrinking or loss of shape. Great quality for a basic essential, and a piece I can see reaching for often. Highly recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
D
Verified Purchase
Dianns
San Leandro, US
★★★★★ 4
The length is perfect. Nice and long.
Color: Yellow, Size: X-Large
These tanks are the perfect length. I love how they fit and feel. I bought these in 5 colors. Although, if you want to keep them long, I suggest hanging them to dry. Putting them in the dryer shrinks the length about 2 inches.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
A
Verified Purchase
Audreen Gieger
Bozeman, US
★★★★★ 5
Great Tank Top
Color: White, Size: Large
I love this top. It fits snug and is comfortable. The length is perfect. I especially like the wide shoulder straps which hides my bra straps. I’ll order more of these in different colors.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
B
Verified Purchase
Bev Bruce
West Palm Beach, US
★★★★★ 5
Very nice quality and fit!
Color: White, Size: Medium
Love love love these tank tops! Really nice ribbed fabric and stark white. I’ll be ordering more and wearing them all summer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026

recommand products