Pay in installments of $70.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 9 - Aug 14
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
TREM2 Fc Chimera Protein, HumanProduct Specification Species Human Antigen TREM2 Synonyms TREM 2, Triggering receptor expressed on monocytes 2 Accession Q9NZC2 1 Amino Acid Sequence His19 Ser174, with C terminal Human IgG1 Fc
Product Specification
| Species | Human |
| Antigen | TREM2 |
| Synonyms | TREM-2, Triggering receptor expressed on monocytes 2 |
| Accession | Q9NZC2-1 |
| Amino Acid Sequence | His19-Ser174, with C-terminal Human IgG1 Fc HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Expression System | HEK293 |
| Molecular Weight | 55-60kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | Human Fc |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1. Deczkowska A, Weiner A, Amit I. The physiology, pathology, and potential therapeutic applications of the TREM2 signaling pathway. Cell. (2020) 181:1207-17. 10.1016/j.cell.2020.05.003 2. Guerreiro R, Wojtas A, Bras J, Carrasquillo M, Rogaeva E, Majounie E, et al.. TREM2 variants in Alzheimer's disease. N Engl J Med. (2013) 368:117-27. 10.1056/NEJMoa1211851 3. Molgora M, Esaulova E, Vermi W, Hou J, Chen Y, Luo J, et al.. TREM2 modulation remodels the tumor myeloid landscape enhancing Anti-PD-1 immunotherapy. Cell. (2020) 182:886-900.e817. 10.1016/j.cell.2020.07.013. |
Background
Triggering receptor expressed on myeloid cells-2 (TREM2) is a transmembrane receptor of the immunoglobulin superfamily and a crucial signaling hub for multiple pathological pathways that mediate immunity. Expressed in the brain, specifically in microglia and in the fusiform gyrus. TREM2 can inhibit the phagocytic function of dendritic cells and macrophages, thereby affecting related immune signaling pathways. TREM2 has vital roles in Alzheimer's disease and other neurodegenerative diseases, and is involved in numerous immune and inflammatory pathways that contribute to the etiology of these diseases. TREM2 has been studied widely in microglia, where TREM2 functions in neuronal debris clearance to counteract the inflammatory response. TREM2 can alter the morphology of tumor-infiltrating macrophages, inhibit tumor growth, and enhance checkpoint blocking therapy. TREM2 can function as a prognostic marker in various malignant tumors because of its role in tumorigenesis and tumor immunity.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy