SKU: 86665497834

AAK1 Protein

Sale price$345.15 Regular price$383.50
Save 10%

Pay in installments of $95.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

AAK1 ProteinProduct Specification Species Human Synonyms AAK1AP2 associated protein kinase 1 Accession Q2M2I8 1 Amino Acid Sequence T27 A365

Product Specification


Species Human
Synonyms AAK1,AP2-associated protein kinase 1
Accession Q2M2I8-1
Amino Acid Sequence

T27-A365

TSGLGSGYIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPEPVKASEAAAKKTQPKARLTDPIPTTETSIA

Expression System Baculovirus-InsectCells
Molecular Weight 40.2 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Liquid
Storage Buffer 20mM Tris, 300mM Nacl, 1mM DTT, pH8.0
Stability & Storage

-80℃

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 86665497834

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
"rhino86oo"
Waukegan, US
★★★★★ 5
My Review...
Format: Paperback
This is a great addition to the Simpsons' book family. It is just like the show, but you can spend as much time reading it as you want. I think this book is extermly fuuny. I have read pretty much every Simpsons' book and this is worth being next with them. I love how the Simpsons' comedy is different than other cartoons and even shows. The comedy is not always dark but it is not always light either. "Little Shop of Homers" was a great finisher. I wish it would of been longer, but it is OK. As with most people, one of my favorite parts in the Simpsons' comics are the in between things. For example, "Moe's Guide To Superstitions", "Bart Simpson-Master Of Disguise presents The Quick 'N' Easy, Low-Budget Do-It-Yourself Guide To COOL COSTUMES". Well, that is all I can really say. I suggest Simpson fans should read this. Keep them coming and I will keep reading.. Have A Nice LiFE! Ryan
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 12, 2000
D
Daniel
Boise, US
★★★★★ 5
Best halloween special yet!
Format: Paperback
This is another of the many must have books for the true simpson fan. This book provides hours of laughs and would make a great gift. It has main stories, and in between shorts such as Springfield in #%*$, and a yocals guide to Halloween. I enjoy this book every time I pick it up, and you should to!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2000
O
Verified Purchase
Omar Sandoval
Belleville, US
★★★★★ 5
Holistic Understanding
Format: Paperback
I passed my CAPM exam in December 2025. This book helped me understand how all the pieces of the puzzle fit together for the CAPM. I also supplemented with other resources, but this book helped really tie everything together. Read it all and do all the practice quizzes and tests to really get a solid understanding. I'll look for PMP related books by the same author. Very well written and easy to understand.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 14, 2026
A
Verified Purchase
Amazon Customer
Grantham, US
★★★★★ 5
Buy this one. It is straight to the point!
Format: Paperback
I don't usually write reviews. But this book was amazing. It was a life saver to have me refresh from my masters degree. I read domains three and four. Then I went through about 400 of the practice questions and was able to ace my exam above target in all domains. It is really easy to follow and I will be using it as a stepping stone when it is time to take the PMP exam. Definitely buy this one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 21, 2025
K
Verified Purchase
Kajur
Lowell, US
★★★★★ 4
Helped Me Pass the CAPM
Format: Paperback
You need more than this to pass the exam, but this is an excellent study guide and structure. The practice questions are way easier than the actual exam. Don't let them give you a sense of false confidence. Especially if you don't have experience. I recommend to Google project management courses, IBM, or there's another one on Udemy. Use the PMI practice exam, too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 7, 2025

recommand products