SKU: 86837469633

Human CD99, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 20 - Aug 25

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD99, His tagProduct Specification Species Human Synonyms 12E7, E2 antigen, Protein MIC2, T cell surface glycoprotein E2, MIC2, MIC2X, MIC2Y Accession P14209 Amino Acid Sequence Protein sequence (P14209, Asp23 Asp122, with C 10*His) DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 11. 8 kDa Observed MW: 17, 30 kDa Purity 95% by SDS PAGE

Product Specification


Species Human
Synonyms 12E7, E2 antigen, Protein MIC2, T-cell surface glycoprotein E2, MIC2, MIC2X, MIC2Y
Accession P14209
Amino Acid Sequence

Protein sequence (P14209, Asp23-Asp122, with C-10*His) DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 11.8 kDa Observed MW: 17, 30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD99 antigen (Cluster of differentiation 99), also known as MIC2 or single-chain type-1 glycoprotein, is a heavily O-glycosylated transmembrane protein that is encoded by the CD99 gene in humans. The CD99 gene does not undergo X inactivation on the X chromosome and it was the first such pseudoautosomal gene to be discovered in humans. It is expressed on all leukocytes but highest on thymocytes and is believed to augment T-cell adhesion and apoptosis of double positive T cells. It also participates in migration and activation. It is found on the cell surface of Ewing's sarcoma tumors and is positive in granulosa cell tumors. It is more expressed in malignant gliomas than in the brain, and such overexpression results in higher levels of invasiveness and lower rates of survival. Antibodies to CD99 are used in diagnostic immunohistochemistry to distinguish Ewing's sarcoma from other tumours of similar histological appearance, as well as for the identification of thymic tumours, and of spindle cell tumours, such as synovial sarcoma, haemangiopericytoma, and meningioma.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 86837469633

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
mary guidry
West Palm Beach, US
★★★★★ 5
Awesome Product
I don't go anywhere without this primer. Sometimes where just the primer. Adds smooth texture and glow to my complexion. Makes putting on foundation a breeze. Feels like silk on the skin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2020
A
Verified Purchase
Absolute perfect
Los Angeles, US
★★★★★ 5
You won’t regret it
I put this on everyday rain or shine day or night it’s wonderful
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 11, 2025
R
Verified Purchase
RHay
Pawtucket, US
★★★★★ 3
Pump stops working
I love this primer and color however the last 2 bottles I have gotten the pump stops working with the container still at least half full. I have to take the entire top off to get to the primer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 28, 2024
K
Verified Purchase
Kelsey F.
Pawtucket, US
★★★★★ 5
Soothes dry, eczema prone skin
Size: 1 Fl Oz (Pack of 1)
My son has moderate eczema and it seems to really flare up when his skin is dry. We started to use this as a final step in his bath time routine and I’ve noticed a pretty big difference in his skin. I usually wash him off with soap, then put this on to sink in for the remainder of his bath and rinse off right at the end. When I don’t use it I notice his skin is drier and more itchy. It is a staple in our bath time routine!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
P
Verified Purchase
Paige
Carnegie, US
★★★★★ 5
Gentle and works well
Size: 1 Fl Oz (Pack of 1)
We really like this! It’s gentle on my daughter’s skin and hasn’t caused any irritation. It lathers nicely without being harsh and leaves her skin feeling clean and soft. A great option if you’re dealing with sensitive or eczema-prone skin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026

recommand products