SKU: 87119004019

Human L-selectin, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 1 - Aug 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human L-selectin, His tagProduct Specification Species Human Synonyms CD62 antigen like family member L, Leukocyte adhesion molecule 1 (LAM 1), Leukocyte surface antigen Leu 8, Leukocyte endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, TQ1, gp90 MEL, SELL, LNHR, LYAM1 Accession P14151 Amino Acid Sequence Protein sequence (P14151, Trp39 Val194, with C 10*His)

Product Specification


Species Human
Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1 (LAM-1), Leukocyte surface antigen Leu-8, Leukocyte-endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, TQ1, gp90-MEL, SELL, LNHR, LYAM1
Accession P14151
Amino Acid Sequence

Protein sequence (P14151, Trp39-Val194, with C-10*His) WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 19.9 kDa Observed MW: 24, 26-33 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

L-selectin, also known as CD62L, is a cell adhesion molecule found on the cell surface of leukocytes, and the blastocyst. L-selectin belongs to the selectin family of proteins, which recognize sialylated carbohydrate groups containing a Sialyl LewisX (sLeX) determinant. L-selectin plays an important role in both the innate and adaptive immune responses by facilitating leukocyte-endothelial cell adhesion events. L-selectin is also expressed by lymphoid primed hematopoietic stem cells and may participate in the migration of these stem cells to the primary lymphoid organs. L-selectin is expressed on embryonic cells and facilitates the attachment of the blastocyst to the endometrial endothelium during human embryo implantation. It is cleaved by ADAM17. L-selectin expressed on CD4 T lymphocytes has been implicated in mediating adhesion and entry of HIV. Deficiency epithelial expression of L-selectin ligands has been associated with infertility, while increased expression has been implicated in ectopic pregnancies. The adhesive properties of L-selectin have been shown to contribute to cancer progression.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 87119004019

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 11 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
LH
Lexington, US
★★★★★ 5
Durable, Perfect Size, and Glows
Color: A) 2-Pack (2.5" Balls)
I bought these for my 23 pound Bojack (Boston Terrier/Jack Russel) mix and he absolutely loves them. He’s an aggressive chewer that has destroyed Kong toys. This ball has just enough flex or give in it that he can’t tear it apart as it compresses in on itself. After about 6 months it started to wear down and tear a bit by the hole so I just tossed it and gave him the other one. I’ll be buying more of these as they wear out over time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
R
Verified Purchase
R. C.
Belleville, US
★★★★★ 5
A Must for Nighttime Fetch!!
Color: A) 2-Pack (2.5" Balls)
These are an absolute Must!! We have an ESS who is nearly 2yo and destroys Every toy he has. For some reason, he doesn't try to annihilate these glow balls. If he chomps on them, it's just for a moment while he is bringing it back to you. Has just a little weight to them so it goes far enough when thrown and a nice bounce when we have to play in the house, due to weather. Wish the bright 'glow' held a little longer but stays dim for quite some time and overall, just Awesome! Also purchased the 'chuck it' brand and sent them back because these were so much better. Will be buying more, if ever needed, but haven't had to because they are So Durable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 12, 2026
L
Verified Purchase
Lance M. Shaw
Belleville, US
★★★★★ 5
Awesome quality glow balls
Color: I) 8-Pack (2.5" Balls)
I have bought every glow ball on amazon many times over for my german shepherds. My longest lasting balls have been the chuck-it, they seem to glow longer and not get destroyed but are expensive. These glow balls are our new favorite and not only because of the low price. They hold a good glow longer are heavy duty and fit the chuck-it thrower perfectly. I am stocking up on these. Shipping was also next day so it's 100% buy on these.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 8, 2026
C
Verified Purchase
Charlow
Lowell, US
★★★★★ 3
Glow in the Dark Balls
Color: 2-Pack (3" Balls)
These balls are ok, not great. The reason they didn’t receive 5 stars is because they are hard/stiff, harder to throw & heavier than the the “Chuck It” glow in the dark balls. They did not hold up to heavy chewers as well as the aforementioned balls.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
A
Verified Purchase
Alicia
Bozeman, US
★★★★★ 5
Bulky
I was a little disappointed in how bulky these were and seemed hard to get on. If you can get past this they do seem to work good. Hands do seem softer and a bit healthier.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 8, 2024

recommand products