SKU: 87453694332

Human IL-6

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 1 - Aug 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-6Product Specification Species Human Synonyms Interleukin 6, B cell stimulatory factor 2 (BSF 2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta 2 (IFN beta 2), IL6, IFNB2 Accession P05231 Amino Acid Sequence Protein sequence (P05231, Val30 Met212)

Product Specification


Species Human
Synonyms Interleukin-6, B-cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta-2 (IFN-beta-2), IL6, IFNB2
Accession P05231
Amino Acid Sequence

Protein sequence (P05231, Val30-Met212) VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Expression System HEK293
Molecular Weight

Predicted MW: 20.8 kDa Observed MW: 20, 21 kDa

Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin 6 (IL-6) is an interleukin that acts as both a pro-inflammatory cytokine and an anti-inflammatory myokine. Osteoblasts secrete IL-6 to stimulate osteoclast formation. Smooth muscle cells in the tunica media of many blood vessels also produce IL-6 as a pro-inflammatory cytokine. IL-6's role as an anti-inflammatory myokine is mediated through its inhibitory effects on TNF-alpha and IL-1 and its activation of IL-1ra and IL-10. There is some early evidence that IL-6 can be used as an inflammatory marker for severe COVID-19 infection with poor prognosis, in the context of the wider coronavirus pandemic. IL-6 stimulates the inflammatory and auto-immune processes in many diseases such as multiple sclerosis, neuromyelitis optica spectrum disorder (NMOSD), diabetes, atherosclerosis, depression, Alzheimer's disease, systemic lupus erythematosus, multiple myeloma, prostate cancer, Behçet's disease, rheumatoid arthritis, and intracerebral hemorrhage.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 87453694332

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
O
Verified Purchase
online shopper
Dallas, US
★★★★★ 4
Easy and it works
Color: Silver, Size: Compact
It works! It doesn’t have different speed settings, and you have to make sure you have the right kind of milk, but so far it’s been great and easy to use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 6, 2026
R
Verified Purchase
Ryan
Omaha, US
★★★★★ 5
Simple upgrade that actually feels worth it
Color: Black, Size: normal
I replaced a cheap milk frother I had from Walmart with this one, and it’s definitely an upgrade. Right out of the box it just feels a bit nicer and more solid, not flimsy like the other one. It’s also noticeably more powerful. It froths milk really quickly and does what it’s supposed to without any effort. I did notice it only has one ring on the whisk compared to the two on my old one, but I honestly don’t notice any difference in how it works. Only small thing was getting the batteries in, which was a little tighter than I expected. Not a big deal, just took a second. Overall, it just works well and feels worth the price. I’ve only had it for a short time, but so far I’m happy with it and hoping it holds up.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026
M
Verified Purchase
musicmenman
Dallas, US
★★★★★ 5
Great frother at a good price
Color: Black, Size: normal
Works really well and priced appropriately. Produces rich froth with minimal effort and works MUCH better than other much higher priced frothers. Highly recommended. I hope it lasts a good long time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
C
Verified Purchase
Cooper Drenner
Belleville, US
★★★★★ 5
Perfect for protein shakes and coffee - one warning about getting it wet
Color: Black, Size: normal
Bought this to replace a similar handheld whisk I had been using for protein shakes and stirring extras into my morning coffee. At this price point I was not expecting much, and it has done exactly what I need - with one warning I will get to. I use this almost every morning. Two jobs: mixing a scoop of whey protein into water or milk so it actually dissolves (no clumps stuck to the side of the shaker), and stirring pre-workout powder or a flavor additive into my coffee. This is not a blender and I do not treat it like one. For small-volume mixing of powders into liquid, it is the right tool. WHAT WORKS - It does not over-froth or whip air into the drink. Some handheld whisks turn a protein shake into a foam mess. This one keeps the liquid liquid - it just dissolves the powder. That is the main reason I came back to this category. - No splashing, even with the cup near the brim. I can stir a nearly-full coffee mug without flicking liquid onto the counter. The previous one I owned could not do this. - One button. Runs as long as I hold it. A typical protein shake or coffee mix takes under ten seconds. - Easy to hand-wash. Rinse the whisk end, wipe the handle, back in the drawer. WHAT DOES NOT (the warning) - You cannot throw the whole thing in the sink with the rest of the dishes. The handle is not waterproof. We made this mistake exactly once - it got soaked, never worked again. At this price the loss was not a big deal, but it is the one thing I wish the listing made more obvious. Hand-clean the whisk end only, keep the handle dry. - Battery-powered. Replace the batteries when it starts feeling slow rather than waiting for it to fully die mid-shake. WHO IT IS FOR If you need a small-volume mixer for protein powder, coffee, hot chocolate, pre-workout, or anything where you are dissolving a powder into a single cup or shaker, this is the tool. If you want to blend smoothies or actually break down ingredients, buy a real immersion blender instead. Five stars. The wet-handle failure was my mistake, not the product's. Doing its job every morning - would buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
D
Verified Purchase
Daniel Flynn
Omaha, US
★★★★★ 4
$7 value
Color: Black, Size: normal
Works wonderfully if the liquid you’re blending has no viscosity, but it slows down brutally if given any kind of resistance. It’s small and lightweight and very easy to use. Works for my bloom, but it does not work very well for my protein shakes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026

recommand products