SKU: 89325493153

Biotinylated CTLA4 His&Avi Tag Protein, Human

Sale price$266.40 Regular price$296.00
Save 10%

Pay in installments of $74.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated CTLA4 His&Avi Tag Protein, HumanProduct Specification Species Human Antigen CTLA4 Synonyms CTLA4,CD152 Accession P16410 Amino Acid Sequence Ala37 Phe162, with C terminal 8*His&Avi tag AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFGGGSHHHHHHHHGLNDIFEAQKIEWHE Expression System HEK293 Molecular Weight 20 27Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Biotin Tag Avi Tag, His Tag Physical

Product Specification


Species Human
Antigen CTLA4
Synonyms CTLA4,CD152
Accession P16410
Amino Acid Sequence

Ala37 - Phe162, with C-terminal 8*His&Avi tag

AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFGGGSHHHHHHHHGLNDIFEAQKIEWHE


Expression System HEK293
Molecular Weight

20-27Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Shuang Qin, Linping Xu, Ming Yi, Shengnan Yu,Kongming Wu & Suxia Luo: Novel immune checkpoint targets: moving beyondPD-1 and CTLA-4: MolecularCancer volume 18, Article number: 155 (2019).


Background

Cytotoxic T-lymphocyte-associated protein 4 (CTLA-4) is an inhibitory receptor belonging to the CD28 immunoglobulin subfamily, expressed primarily by T-cells. The family includes CD28, CTLA-4 and ICOS as well as other proteins including PD-1, BTLA and TIGIT.Its ligands, CD80 and CD86, are typically found on the surface of antigen-presenting cells and can either bind CD28 or CTLA-4, resulting in a costimulatory or a co-inhibitory response, respectively. Because of its dampening effect, CTLA-4 is a crucial regulator of T-cell homeostasis and self-tolerance. The mechanisms by which CTLA-4 exerts its inhibitory function can be categorized as either cell-intrinsic (affects the CTLA-4 expressing T-cell) or cell-extrinsic (affects secondary cells). CTLA-4 mainly acts in a cell-extrinsic manner via its competition with CD28, CTLA-4-mediated trans-endocytosis of CD80 and CD86, and its direct tolerogenic effects on the interacting cell.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 89325493153

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Some Guy
Draper, US
★★★★★ 4
Durable But Quirky Interactive Ball
Color: Blue
I am 30 now and my tolerance for toys that break in 2 minutes is basically zero. I picked this up during a weekend DIY project when I was fixing the deck and needed something to keep the dog occupied. The E TPU material is straight up impressiveuch abuse it can take from a large breed. My dog tends to destroy generic store brand balls but this one survived being dropped down the stairs and tossed against the siding. It is comfortable enough to use daily without feeling like it is going to shatter or hurt the dog. The internal compartment where you charge it is smart and those little pockets for the charging port are actually useful sized for my fat fingers. The smart movement is a game changer for keeping a high energy dog moving when I am busy with home improvement tasks. I was slightly worried about the 8 hour battery life but it holds a charge well enough for a few play sessions. My whole household uses this now to entertain the dog as he will not leave us alone otherwise. It works best on my kitchen tiles but it barely moves on the thick rug in the living room which is frustrating. The vibration is loud enough to be annoying when I am trying to focus on work. It is a solid 3 star product as it does what it says but has some quirks that make it less than perfect. Spending 19.99 is fair for the durability you get compared to cheaper options. I like that it is USB rechargeable instead of eating through batteries. It is not perfect but it serves a purpose in my chaotic house.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 28, 2026
F
Frank Paprota
Birmingham, US
★★★★★ 5
Engaging and Durable: High-Energy Play with a Caveat for Sensitive Pups
Color: Blue, Color: Blue
Finding an automated toy that can survive the jaws of an aggressive chewer while keeping them physically engaged is a major win for busy pet owners. This smart interactive dog toy offers an excellent, high-tech way to keep high-energy dogs active, though its enthusiastic movement might be a bit intense for more timid pets. Dynamic and Instinct-Triggering Movement: The core appeal of this toy is its smart interactive movement. This automatic bouncing ball activates immediately upon touch, rolling and bouncing in entirely unpredictable directions. This erratic motion successfully triggers a dog's natural chasing instincts, keeping them thoroughly engaged and entertained for hours, which is incredibly helpful when you are unavailable to play. However, because the movement is so sudden and dynamic, it can occasionally scare more sensitive or easily startled dogs. Chew-Proof and Safe Construction: The durability and structural safety of the ball are highly impressive: *Chew-Proof E-TPU: Crafted with a high-density E-TPU shell, the toy is specifically built to withstand aggressive chewing and rough play from medium to large breeds. It holds up remarkably well against scratches and deep bites for long-lasting use. *Pet-Friendly Materials: The non-toxic, BPA-free material is completely safe and remains gentle on your dog's teeth and gums during fetch or heavy chewing sessions. *Injure-Free Design: The toy is engineered with smooth, rounded edges to prevent any accidental cuts or injuries during high-speed play. Supporting an Active Lifestyle: This toy serves as a fantastic tool for supporting an active lifestyle. It encourages vital daily exercise to help maintain your dog's physical health, significantly reduces boredom, and curbs destructive behaviors like furniture chewing. This makes it an absolute lifesaver for high-energy pups that need a constant physical outlet. Convenient USB Rechargeability: Powering the toy is simple and environmentally friendly. It is equipped with a USB rechargeable battery that delivers up to 8 hours of continuous play on a single charge. It also includes the necessary USB charging cable, ensuring you can quickly plug it in and have it ready for the next play session without constantly buying disposable batteries. Bottom Line: I highly recommend this smart interactive dog toy for owners of high-energy, medium-to-large breeds that need an indestructible, engaging outlet. While it may frighten more timid or anxious dogs due to its unpredictable bouncing, its premium E-TPU durability, great battery life, and excellent exercise value make it a fantastic investment for a healthier, happier pet.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
S
Silverbullet875
San Leandro, US
★★★★★ 5
Ymswznwe Smart Interactive Dog Toy, Pet Automatic Moving Bouncing Ball, Chew-Proof
Color: Blue, Color: Blue
This toy has been so much fun to watch my dogs interact with. I love the randomness of the movements because it keeps them guessing and keeps the toy interesting instead of becoming predictable after five minutes. They definitely weren’t sure what to think of it at first, but once they figured it out, it became hilarious entertainment. One of my dogs especially likes to hold it in his mouth and just let it vibrate, which cracks me up every time. I think toys like this are great not only for physical activity, but also for mental stimulation and curiosity. It gets them engaged in a different way than a regular ball or chew toy. While I wouldn’t consider my dogs “power chewers,” toys usually do not last long around here, so I was pleasantly surprised by how well this has held up. At the time of this review, it still looks basically brand new, so it is pretty durable. I also really appreciate that it’s rechargeable. I’m glad I’m not constantly going through batteries with a toy like this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2026
A
Amazon Customer
Dallas, US
★★★★★ 2
Interesting Premise
Color: Blue, Color: Blue
It's an interesting premise for a toy -- it has a vibrating gyrator in the middle which turns on randomly for random durations. This then causes the ball to vibrate and roll around the floor. It really needs to be on a hardwood floor to move, though -- when I put it on their dog bed, it vibrates but then doesn't move anywhere. I tried a few times to get my four dogs to interact this this ball toy, but they are clearly not interested.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 20, 2026
A
Verified Purchase
Amazon Customer
Whiting, US
★★★★★ 5
Great toy for a dog who is not afraid of noises
Color: Crab
My puppy loves this thing! She was confused at first but now she plays with it daily. I just let it jump and sing the first time. She looked at it with the cutest head tilt. It is a bit loud so if you have a dog that's scared of noises this might be the right toy. Now when she picks it up, I turn it on and she gets so excited! The different songs make the toy less annoying for me, lol. Honestly, anything to tire out a 4 month old puppy. She is very entertaining to watch.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026

recommand products