SKU: 89720437422

LAIR1/CD305 His Tag Protein, Mouse

Sale price$270.00 Regular price$300.00
Save 10%

Pay in installments of $75.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LAIR1/CD305 His Tag Protein, MouseProduct Specification Species Mouse Accession Q8BG84 Amino Acid Sequence Gln22 Tyr141, with C terminal 8*His QEGSLPDITIFPNSSLMISQGTFVTVVCSYSDKHDLYNMVRLEKDGSTFMEKSTEPYKTEDEFEIGPVNETITGHYSCIYSKGITWSERSKTLELKVIKENVIQTPAPGPTSDTSWLKTYGGGSHHHHHHHH Expression System HEK293 Molecular Weight 23 33kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4

Product Specification


Species Mouse
Accession Q8BG84
Amino Acid Sequence

Gln22-Tyr141, with C-terminal 8*His QEGSLPDITIFPNSSLMISQGTFVTVVCSYSDKHDLYNMVRLEKDGSTFMEKSTEPYKTEDEFEIGPVNETITGHYSCIYSKGITWSERSKTLELKVIKENVIQTPAPGPTSDTSWLKTYGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 23-33kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Leukocyte-associated immunoglobulin-like receptor-1 (LAIR-1) is a type I glycoprotein of 287 amino acids containing a single extracellular Ig-like domain followed by a stalk region connected to the single transmembrane domain and 2 cytoplasmic immunoreceptor tyrosine-based inhibitory motifs that relay the inhibitory signal. LAIR-1 is expressed on almost all immune cells, including NK cells, T cells, B cells and mono-cytes, monocyte-derived dendritic cells, eosinophils, and basophils and mast cells. LAIR-1 binds both transmembrane and extracellular matrix collagens. The mLAIR-1 gene maps to the proximal end of mouse chromosome 7 in a region syntenic with human chromosome 19q13.4 where the LRC is located. LAIR-1 are involved in controlling the balance of the immune system to prevent improper activation or overactivation, which may result in tissue damage or autoimmune diseases. LAIR1 has been shown to inhibit T and NK cell activation mediated by several activating receptors. Furthermore, it has been shown that LAIR1 can deliver an inhibiting signal on intracellular free calcium concentration and immunoglobulin (Ig) production induced by the engagement of B cell antigen receptors (BCR).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 89720437422

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
GritWork
Louisville, US
★★★★★ 5
Real walnut wood. High quality.
Color: Walnut Wood, Size: Large, Color: Walnut Wood, Size: Large
This is authentic walnut wood. I was apprehensive at first. My fear was that it was pine stained to the color of walnut. I thought the wood stain would come off on my wrists and wear over time. Turns out this is a genuine chunk of walnut! Worth the $20. I laser engraved my logo onto it and it revealed that it’s 100% walnut to the core. Elegant solution. Perfectly comfortable. Way less corny than those squishy wrist rests from the 2000’s. Nice rubber gaskets on the bottom to keep it from slipping. Does not move while in typing. The exact right size for supporting your wrist on a full size Keychron keyboard. I’m using it with a P6 Ultra. But it would fit any full size Keychron keyboard.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 23, 2026
T
Verified Purchase
The Cannish
Massapequa, US
★★★★★ 5
Surprisingly comfortable and stylish wrist rest!
Color: Walnut Wood, Size: Large
This wrist rest is the perfect compliment to my desk set up. I was hesitant about buying a wood product like this, but I’ve been pleasantly surprised how comfortable and smooth it is during extended use. For the price, it feels like a premium product, and I love that it stays put with the rubber feet. The size is perfect for a full-size keyboard, with just the right thickness to keep your wrist and palms comfortable. If you’re looking for an elevated way to decorate your desk while protecting your wrist, this is a great choice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2026
T
Verified Purchase
Thomas Wells
Battle Creek, US
★★★★★ 5
Great wrist rest with a modern look!
Color: Walnut Wood, Size: Medium, Color: Walnut Wood, Size: Medium
This is a great looking addition to my desk. It’s a just the right length to fit my keyboard and I love the walnut coloring! It’s real wood and has nice rubber feet on the bottom to keep it from moving around. The angle is nice for my wrists and it’s easy to clean with just a damp cloth. If I ever wear this one out (which I doubt) I’d buy another!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 31, 2026
E
Verified Purchase
Elektra
Natrona Heights, US
★★★★★ 5
Super comfortable - much better than memory foam wrist rests!
Color: Walnut Wood, Size: Large, Color: Walnut Wood, Size: Large
Get this wrist rest - you won't be disappointed. Had ergonomic keyboards and have tried memory foam rest in the past and this is much better. Smooth wood, perfect height and very supportive to keep wrists in neutral position when typing. Got the 17.3" and like that there's ample room to not feel squashed, but probably could have done with the medium length. Great angle for my mechanical keyboard. Love it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
J
Verified Purchase
James M.
Fort Morgan, US
★★★★★ 4
What an excellent wrist rest! Except for this one thing....
Color: Walnut Wood, Size: Large
This is a solid piece of wood with great quality. Fantastic large rubber grips on the bottom (left and right sides only). Pro: I use it for editing and gaming. And though I thought the wood might be a bad choice in the long run, it turns out it's pretty nice. Not as comfortable as a gel rest but I knew what I was getting when I ordered it. I buy things for function AND aesthetics. I love how this looks. The uniqueness is really something. I got the natural one instead of the black so that the grains and lines can be easily seen. Con: Unfortunately, after almost 2 months, the wood has warped some. Not enough to effect my typing but, enough that I notice it. The warp is the kind where the opposite angled corners go up and down. While the other 2 corners are fine. In my case, the top left and bottom right, when pressed independently, rock the wrist rest. The top right and bottom left stay grounded. This is why I took a star off. Because there's no way this should be happening. So, looks and quality are up there. The rubber grips are solid. Why it's warping is puzzling to me. NO liquid wasted on it. Or, extreme temperature changes have happened. I've made sure the rubber grips. And that the surface the rest sits on (a glass mouse scrolling top by Superglide) is clean. Yet, I get this slight rocking. It bugs me this all happened right after the return window closed. I would've simply exchanged it. I love it too much. I mean, this is, again, a SOLID piece of wood. Maybe this won't happen for everyone. I mean, it's wood. Eh I would still recommended this regardless.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 24, 2025

recommand products