Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 7 - Jul 12
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
FABP2 His Tag, HumanProduct Specification Species Human Accession P12104 Amino Acid Sequence Met1 Asp132, with C terminal 8*His MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKDHHHHHHHH Expression System E. coli Molecular Weight 16. 5kDa (Reducing) Purity 98% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Reconstitution
Product Specification
| Species | Human |
| Accession | P12104 |
| Amino Acid Sequence | Met1-Asp132, with C-terminal 8*His MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKDHHHHHHHH |
| Expression System | E.coli |
| Molecular Weight | 16.5kDa (Reducing) |
| Purity | ＞98% by SDS-PAGE & RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Reconstitution | Reconstitute at 0.1-1mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
FABP2 is expressed solely in the small intestine, and may control development of the small intestine particularly in response to diet. FABP2 null animals were shown to be resistant to high fat diet induced obesity. FABP2 KO mice fed a high saturated fat low fiber diet showed reduced intestinal villi length and increased transit time, as well as decreased goblet cell density and paneth cell number. Epidemiological studies have long shown that the common Ala54Thr FABP2 polymorphism in humans is associated with metabolic syndrome. The Thr54 FABP was shown to have a slightly higher affinity than the Ala54 containing protein, and human fetal intestinal explants showed that subjects with the Thr54 polymorphism had increased levels of chylomicron secretion . Thus while the complete molecular mechanisms linking these biochemical and cellular observations to the population-based observations remain to be revealed, nutritional intervention strategies may prove helpful in treating metabolic syndrome in Ala54Thr carriers.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.4 ★★★★★
Based on 2074 reviews
Sort
Product Reviews
★★★★★ 3
Chew proof except for stuffing
Color: Grey, Color: Grey
I left Sage with her new chew toy and was distracted by something in the other room. I came back not 5 minutes later, and this was what I saw! Stuffing all over the floor! And that was just the beginning. By the end of the day, I had cleaned up stuffing several times from separate sessions with the toy! The rest of the poor toy is holding together, except that it has lost a couple of squeakers. I don't know whether to recommend it or not. Sage is exceptionally, extraordinarily, extremely, immensely, and profoundly aggressive when she chews (on inanimate objects only -- no humans or other animals!).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2023
★★★★★ 5
Great hit with my dog
Color: Grey, Color: Grey
The gray rhino is a great hit with my dog. She's a medium size golden (53lbs) likes to chew and tug, but she is not not too aggressive with toys, and this has become her favorite toy. Over the last 2 weeks she's removed the top arms from the body and "killed" one of the squeakers, and the arms are now a separate tug toy. We could have put the arms back, but she figured out those come off, and she would take them out again. The armless rhino is still the one she carries around from room to room, plating tug and fetch with every day. The toy is very well stitched, the fabric is of good quality and there are no small pieces that come apart to be swallowed. It gets dirty from all the playing so I plan to throw it in the wash every month or so.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2024
★★★★★ 5
Love it!!!
Color: Grey
I have bought three of these for my French bulldog. She has went through three of them already. She loves this toy highly recommend for an energetic dog.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 6, 2026
★★★★★ 5
Great toy
Color: Grey
My girl loves this toy. She has a lot of toys but this is her favorite. She is a 26 lb mini golden and we have had it over a year. It is just now starting to show wear. Once it is completely worn out I will buy it again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2025
★★★★★ 5
Durable product.
Color: Grey
My dog loves it. Very durable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 12, 2026
recommand products
NO 895 - Cullercoats Bay, Northumberland c1926
13.00
NO 838 - Alnmouth Fishermen, Northumberland
18.00
Sol de Janeiro Brazilian Bum Bum Visibly Firming Refillable Body Cream
5500.00
NO 871 - New Connection Zion Church, Blyth, Northumberland
13.00
The Matcha Cleanse Daily Clarifying Gel Cleanser
1400.00