SKU: 90384198176

VHL His&AVI Tag Protein, Human

Sale price$468.00 Regular price$520.00
Save 10%

Pay in installments of $130.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

VHL His&AVI Tag Protein, HumanProduct Specification Species Human Synonyms HRCA1 Protein, Human; pVHL Protein, Human; RCA1 Protein, Human; VHL1 Protein, Human Amino Acid Sequence Met1 Asp213, with N terminal His SUMO & C terminal AVI Tag

Product Specification


Species Human
Synonyms HRCA1 Protein, Human; pVHL Protein, Human; RCA1 Protein, Human; VHL1 Protein, Human
Amino Acid Sequence

Met1-Asp213, with N-terminal His SUMO & C-terminal AVI Tag

MGSSHHHHHHSSGLVPRGSHMASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGMPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGDGLNDIFEAQKIEWHE

Expression System E.coli
Molecular Weight 45 kDa
Purity

>85% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag Avi Tag, His Tag
Physical Appearance Liquid
Storage Buffer 20 mM PB,100 mM KCl,0.1 mM EDTA ,2 mM DTT, pH 7.5
Reconstitution A hardcopy of datasheet with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90384198176

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Ripped Off
Houston, US
★★★★★ 5
Great quality!
Size: 10-11, Color: Jacquard Knit Red/Black
Just the best! Comfy! Warm! Great non-slip bottoms! Husbands second pair and will order again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
T
Verified Purchase
Thomas Clendening
Alexandria, US
★★★★★ 5
Best Muclucs I've every owned....GREAT PRICE!
These things are so comfortable and warm. I sleep with them on because I like to have my feet out of the covers. Not too warm...just right. Great quality and fit with a non-slip leather-like sole. I'll keep ordering these ahead of time to make sure I'll always have a fresh pair when I wear them out. I wear them EVERY NIGHT and keep them on all morning. Life-changer! The BEST EVER!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 4, 2026
B
Verified Purchase
Beth
San Leandro, US
★★★★★ 5
Comfy slippers
Size: 10-11, Color: Cable Knit Coffee
Needed these for wood floors cause socks kept wearing out.perfect slipper ..warm and durable
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
R
Verified Purchase
Robert&Robbie
Lowell, US
★★★★★ 4
Great for indoor use.
Size: 10-11, Color: Cable Knit Navy
I bought a pair of these for myself about a year ago and there are plusses and minuses to them. They are comfortable and warm, without getting my feet sweaty or whatever. That's exactly what I wanted. On the minus side, mine ran far too small. I am a 10.5-11 shoe size and the 10-11 is about a half inch too short... my heels are sliding off the back. I am reordering a size 12-13 to try that one. In the take note column, the soles are NOT rubberized in any way. In fact they are like foam, and will absorb water! Also they do not provide cushioning against any kind of rough surface. I think they are perfect for strictly inside the apartment use, but they are not like moccasins or something that allow outdoor use. And I am ordering a 2nd pair after a year so I do like them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 24, 2025
J
Verified Purchase
Jeffery Mercer
San Leandro, US
★★★★★ 5
They are of great quality!
Size: 12-13, Color: Cable Knit Coffee
Love em! After a year and there still Great and warm and Cozy too!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026

recommand products