SKU: 90649562857

IFN-γ His Tag Protein, Human

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 8 - Aug 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IFN-γ His Tag Protein, HumanProduct Specification Synonyms IFN ,Immune Interferon,type II interferon,T cell interferon,MAF,IFNG,IFG,IFI,IFN gamma Accession P01579 Amino Acid Sequence QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQGGGGSHHHHHHHHHH. Expression System HEK293 Molecular Weight 18. 5 kDa (Reducing) Purity >95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag

Product Specification


Synonyms IFN-γ,Immune Interferon,type II interferon,T cell interferon,MAF,IFNG,IFG,IFI,IFN-gamma
Accession P01579
Amino Acid Sequence

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQGGGGSHHHHHHHHHH.

Expression System HEK293
Molecular Weight 18.5 kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized powder
Storage Buffer

0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

IFN-gamma, the only member of type II interferon, is a soluble dimer cytokine secreted mainly by natural killer cells (NK) and natural killer T cells (NKT) when it functions in innate immunity. During antigen-specific immunity it is secreted by CD4 Th1 and CD8 cytotoxic T cells.IFN-gamma acts on the whole process of tumorigenesis and development, and its anti-tumor mechanism is mainly divided into immune mechanism and non-immune mechanism.IFN-gamma can directly inhibit tumor cell proliferation, promote tumor cell apoptosis, inhibit tumor angiogenesis, and cooperate with NK, NKT, γδT cells and CD4+/CD8+T cells of innate and adaptive immunity to complete tumor killing. In addition, IFN-gamma also has an important immunomodulatory function, which can improve the lysosomal activity of macrophages, and has an anti-proliferation effect on transformed cells.This product is the recombinant human Renin protein expressed from human 293 cells (HEK293).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90649562857

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tom
Omaha, US
★★★★★ 4
Works, but reimbursement for damaged items come via Amazon Gift Card, not Cash
Just confirming that this protection plan actually works. Asurion first told me that they'd try and repair my item. Likely, they couldn't find someone to repair the type of item I bought (KVM), so they offered payment (original cost of the item) via Amazon Gift Card. Giving 4 out of 5 stars -> 4 instead of 5 because Amazon Gift Card isn't Cash. Cash is always better.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2026
P
Verified Purchase
Polyphonic
Dallas, US
★★★★★ 5
When Acer's Warranty Policy left my high and dry, Asurion Protection came to the rescue
My Acer Monitor was damaged during a brownout due to a lightning strike close to my house; Acer Customer Support told me that their warranty did not cover this sort of damage but luckily for me, Asurion Protection did. I simply mailed them the item for repairs with their shipping label, and once they realized that the item was damaged beyond repair, they emailed me an Amazon Gift Card Code with the amount spent on the monitor; I'm extremely happy that I bought their protection because without it, I would have had to pay the price of a new monitor to get my PC Setup back into commission. Many Thanks, Asurion Protection
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 15, 2023
G
Verified Purchase
Gerardo Medina
Phoenix, US
★★★★★ 5
Bad product, great service
Process was simple and easy. They couldn't repair my device but did send me the gift card within 1 business day
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 14, 2025
D
Verified Purchase
Dillion
Belleville, US
★★★★★ 1
Don't trust asurion
I first contacted Amazon for this product when I didn't receive this. I bought this back in October 22nd or 23rd with my Lenovo chromebook idea pad flex which it's now December 16th on a Friday night I have yet to receive it. I first contacted Amazon about it November 3rd they said to give asurion a week to back it up for the email delivery. Waited a couple weeks ans nothing happened, contacted Amazon and they put me on with asurion which I then revived a text through tech support saying I'll receive it soon, give them 24 hours to respond with it. Going through 2 links and 2 sites, an email verification a phone number verification and an Amazon sign in "Sorry, we are unable to find your plan." Was the response I was given after all of that. It then put me through the sign-ins again, at the very start of the last 45 minutes hence why I'm writing this. Not to mention the last month I've been trying to contact them for email delivery of my protection plan. I spent $108+ tax on the 4 year protection plan on the upgraded version of my chromebook IdeaPad, which was a gift to someome special to me. Now if It shuts down tomorrow it's not going to get the honored 4 year protection plan, warranty. The device was expensive and asurion can't even honor their own protection plans.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 17, 2022
A
Verified Purchase
Amanda
Lowell, US
★★★★★ 5
Perfect sublimation paper!
Size: 8.5"x11"
The print quality is really good. I’ve had no issues so far. When sublimating, the colors are very vibrant! The paper is very great quality. Definitely worth every penny.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026

recommand products