SKU: 90730583304

Rat Ig gamma-1 chain C region, His tag

Sale price$112.50 Regular price$125.00
Save 10%

Pay in installments of $31.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rat Ig gamma-1 chain C region, His tagProduct Specification Species Rat Accession P20759 Amino Acid Sequence Protein sequence (P20759, Ala1 Lys326, with C 10*His)

Product Specification


Species Rat
Accession P20759
Amino Acid Sequence

Protein sequence (P20759, Ala1-Lys326, with C-10*His) AETTAPSVYPLAPGTALKSNSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSGLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPRNCGGDCKPCICTGSEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISQDDPEVHFSWFVDDVEVHTAQTRPPEEQFNSTFRSVSELPILHQDWLNGRTFRCKVTSAAFPSPIEKTISKPEGRTQVPHVYTMSPTKEEMTQNEVSITCMVKGFYPPDIYVEWQMNGQPQENYKNTPPTMDTDGSYFLYSKLNVKKEKWQQGNTFTCSVLHEGLHNHHTEKSLSHSPGKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 37.6 kDa Observed MW: 45-70 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Ig gamma-1 chain C region (IGHG1) is considered an emerging prognostic marker. The upregulation of IGHG1 is strongly associated with various malignancies, including colorectal cancer, gastric cancer, prostate cancer, papillary thyroid carcinoma, leukemia, ovarian cancer, and breast cancer. In colorectal cancer, the upregulation of IGHG1 contributes to increased cellular proliferation. MEK-FECH signaling is upregulated in IGHG1-overexpressing colorectal carcinomas. IGHG1 overexpression has also been reported for the induction of epithelial to mesenchymal cell transmission (EMT) in gastric cancer via tumor growth factor beta (TGF-β)/SMAD3 signaling. In prostate cancer, the inhibition of IGHG1 is linked to the suppression of MEK/ERK/c-Myc signaling, leading to reduced malignant growth. The increased expression of IGHG1 in breast cancer cells activates AKT and vascular endothelial growth factor (VEGF) signaling, leading to enhanced cell proliferation, invasion, and angiogenesis. IGHG1-silencing can suppress the neoplastic characteristics of breast cancer cells in vitro and suppresses tumor growth in nude mice.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90730583304

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Janis H.
Pawtucket, US
★★★★★ 5
Great shoes
Size: 3.5 Big Kid, Color: Hot Pink/Multi
These shoes are awesome! Have good arch support and very comfortable
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
S
Verified Purchase
Shelby g
Chelsea, US
★★★★★ 5
Awesome shoes!
Size: 4 Big Kid, Color: Aqua/Multi
My daughter is SUPER picky about shoes and loves these. They are easy and quick to put on, run true to size, and most important COMFORTABLE. She is outgrowing them and will have to get her the next size up. Highly recommend for picky kids
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 4, 2025
L
Verified Purchase
LORI
Lowell, US
★★★★★ 5
LOVE THESE
Size: 3 Little Kid, Color: Hot Pink/Multi
Really nice. Pix don’t do them justice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
W
Verified Purchase
Working Momma
Charlottesville, US
★★★★★ 5
Great for busy feet
Size: 13 Little Kid, Color: Hot Pink/Multi, Size: 13 Little Kid, Color: Hot Pink/Multi
My five-year-old daughter loves these Skechers slip-ins—and she is not easy on her shoes! You can see in the photo, she’s already put plenty of miles on them. They’ve been through the washing machine at least twice and still look great—the bright colors are a big hit with her and they hold up well in the wash. One of the elastic bands on top did come loose, but I was able to fix it quickly with a dab of superglue. She slips them on and off all by herself, which is perfect as we’re still learning to tie laces. All in all, a great purchase for the price—especially since kids grow so fast and put their shoes through a lot!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2025
K
Verified Purchase
KelQL
Chelsea, US
★★★★★ 5
Cute slip-ons - so easy and quick!
Size: 13 Little Kid, Color: Hot Pink/Multi
These shoes are adorable, comfortable according to my kid, and super easy to pull on!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 17, 2026

recommand products