SKU: 9157598489

Human CGA, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CGA, His tagProduct Specification Species Human Synonyms Anterior putuitary glycoprotein hormones common subunit alpha; Choriogonadotropin alpha chain; Chorionic gonadotrophin subunit alpha (CG alpha); Follicle stimulating hormone alpha chain (FSH alpha); Follitropin alpha chain Accession P08515 Amino Acid Sequence Protein sequence(P01215, Ala25 Ser116, with C 10*His)

Product Specification


Species Human
Synonyms Anterior putuitary glycoprotein hormones common subunit alpha; Choriogonadotropin alpha chain; Chorionic gonadotrophin subunit alpha (CG-alpha); Follicle-stimulating hormone alpha chain (FSH-alpha); Follitropin alpha chain
Accession P08515
Amino Acid Sequence

Protein sequence(P01215, Ala25-Ser116, with C-10*His)
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 11.8kDa Actual: 25kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Glycoprotein hormones, alpha polypeptide is a protein that in humans is encoded by the CGA gene. The gonadotropin hormones, human chorionic gonadotropin, luteinizing hormone, follicle-stimulating hormone, and thyroid-stimulating hormone are heterodimers consisting of alpha and beta subunits that are associated non-covalently. The alpha subunits of these four human glycoprotein hormones are identical; however, their beta chains are unique and confer biological specificity. The protein encoded by this gene is the alpha subunit and belongs to the glycoprotein hormones alpha chain family.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 9157598489

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Angelwake
Dallas, US
★★★★★ 4
Fun ball for my big Golden Retriever!'
Color: Orange, Color: Orange
It's big and has some weight to it in comparison with ither balls that hardly weigh anything. My 4 year old Golden Retriever can get his jaws around it only just! The squeaky is tough to get squeaking especially if you have a smaller dog. My dog is about 100 lbs and can just barely bite it hard enough to make it squeak. Very cute toy and I pretty sure this is going to last him a long time because it really seems very durable! He loves it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 21, 2026
J
Verified Purchase
Jo Gibson -Moore
New York, US
★★★★★ 5
Ball
Color: Orange
My baby loves her new ball even though it arrived late it’s her new favorite toy
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
M
Verified Purchase
Marge Horstman
San Leandro, US
★★★★★ 3
Very Hard
Color: Brown Bone
Good quality, bit really hard to squeak.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026
A
Verified Purchase
Allie
Pawtucket, US
★★★★★ 5
Durable and tough
Color: Red
Very durable and squeaker is still intact which doesn’t happen often with my mastiff mix. Definitely one of his favorite toys.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
T
Verified Purchase
Tiffany Jackson
Waukegan, US
★★★★★ 4
Chew toy
Color: Red
It’s a great chew toy for dogs and definitely keeps them entertained for hours however, it’s not durable enough for really strong chewers. I have two pitbull puppies and in five days he tore the end off of it. I do recommend for medium sized dogs.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 19, 2025

recommand products