SKU: 92188117322

AGER His Tag Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

AGER His Tag Protein, HumanProduct Specification Species Human Synonyms RAGE, Receptor for advanced glycosylation end products Accession Q15109 Amino Acid Sequence Ala23 Ala344, with C terminal 8*His

Product Specification


Species Human
Synonyms RAGE, Receptor for advanced glycosylation end products
Accession Q15109
Amino Acid Sequence

Ala23-Ala344, with C-terminal 8*His AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALAGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 47-54kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Vissing H., Aagaard L., Tommerup N., Boel E. Localization of the human gene for advanced glycosylation end product-specific receptor (AGER) to chromosome 6p21.3. Genomics. 1994;24(3):606–608.
2.Yan S. D., Chen X., Fu J., et al. RAGE and amyloid-β peptide neurotoxicity in Alzheimer’s disease. Nature. 1996;382(6593):685–691.
3.Deane R., du Yan S., Submamaryan R. K., et al. RAGE mediates amyloid-β peptide transport across the blood-brain barrier and accumulation in brain. Nature Medicine. 2003;9(7):907–913.
4.Krechler T., Jáchymová M., Mestek O., Žák A., Zima T., Kalousová M. Soluble receptor for advanced glycation end-products (sRAGE) and polymorphisms of RAGE and glyoxalase I genes in patients with pancreas cancer. Clinical Biochemistry. 2010;43(10-11):882–886. 2010.04.004.

Background

AGER (advanced glycation end-product-specific receptor encodes a cell surface receptor for advanced glycation end-products (RAGE). This gene is located on the short arm of chromosome 6: 6p21.3. This locus is involved in inflammatory and immune responses and is also the locus of major histocompatibility complex III. Recently, sRAGE was demonstrated as a new biomarker for lung cancer and RAGE could be a potential therapeutic target in Alzheimer's disease. The genetic background of RAGE demonstrated that some gene polymorphisms are implicated in various pathological states, for example, diabetes complications, amplification of the inflammatory response, non-small cell lung cancer, gastric cancer, or breast cancer.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 92188117322

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Cait E
Massapequa, US
★★★★★ 5
These ACTUALLY stay put all day long - I was skeptical, but am so glad I took a chance on these
Size: Medium, Color: (014) Halo Gray / Halo Gray / Castlerock
I was so skeptical about whether these would stay on my feet all day without sliding down into my shoe - I’ve tried so many socks in the past with the silicone strip on the heel which failed. I’ve owned these for a couple months now and they have never slipped down - they stay put all day! I love the variety of colors to choose from, and the value per pack is great since six pairs come per pack (I thought it was only three when I first purchased and was pleasantly surprised by the additional pairs). They also have perfect thickness - not too warm to wear during the summer months with sneakers; I live in a tropical climate, though, so I’m not sure how they will do in cooler climates. I’ve washed each pair once or twice and the color and quality of the silicone has stayed so far (knock on wood). Overall: high recommend based on my experience so far!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 13, 2025
M
Verified Purchase
Maggie Vega
Houston, US
★★★★★ 5
Great fit!
Size: Medium, Color: (403) Washed Navy / Washed Navy / Blue Smoke
Great quality!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
K
Verified Purchase
Kira Stewart
West Palm Beach, US
★★★★★ 5
My favorite socks
Size: Medium, Color: (659) Fuchsia Dusk / Fuchsia Dusk / Tourmaline Pink
Very comfortable. True to size. Moisture wicking
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
T
Verified Purchase
Theresa
Alexandria, US
★★★★★ 4
No show but stays on
Size: Medium, Color: (014) Halo Gray / Halo Gray / Castlerock
I wear these socks daily. They truly don’t show with my workout shoes or with hey dudes. But the best thing about them is that they actually stay on your foot. I work out hard and I don’t ever have to pull them up. I do wish they were just a little bit thicker than they are, but they are definitely a product I will buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
A
Verified Purchase
Andrew B
Los Angeles, US
★★★★★ 5
High Quality
Number of Items: 6, Color: Black (6-pairs), Size: Large
High quality and fit great
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026

recommand products