Human IL-12A, His tag
SKU: 92221628047

Human IL-12A, His tag

Sale price$166.50 Regular price$185.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-12A, His tagProduct Specification Species Human Synonyms Cytotoxic lymphocyte maturation factor 35 kDa subunit (CLMF p35), IL 12 subunit p35, NK cell stimulatory factor chain 1 (NKSF1), NKSF1 Accession P29459 Amino Acid Sequence Protein sequence (P29459, Arg23 Ser219, with C 10*His)

Product Specification


Species Human
Synonyms Cytotoxic lymphocyte maturation factor 35 kDa subunit (CLMF p35), IL-12 subunit p35, NK cell stimulatory factor chain 1 (NKSF1), NKSF1
Accession P29459
Amino Acid Sequence

Protein sequence (P29459, Arg23-Ser219, with C-10*His) RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 24.2 kDa Observed MW: 35-45 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin-12 subunit alpha (IL-12 p35) is a protein that in humans is encoded by the IL12A gene. This gene encodes a subunit of the cytokine Interleukin 12 (IL-12) that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-dependent induction of interferon gamma (IFN-γ), and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 92221628047

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 2419 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Colleen Ellis
Houston, US
★★★★★ 5
No assembly required
Color: Light Beige, Size: 6-Panel
Absolutely love this! Arrived in a timely manner and it’s very versatile. Blocks the light on our porch on a hot day. Very durable and stable product. The color was as expected and there is no assembly required.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
M
Verified Purchase
Mowrind
Alexandria, US
★★★★★ 3
Looks ok if you don't look too close. Not likely to last long.
Color: Light Beige, Size: 6-Panel, Color: Light Beige, Size: 6-Panel
Got here fast, which was great since our company "upgraded" its video conferencing software and virtual backgrounds no longer work. But I can only describe the item as rickety and sloppily built. See photos: visible gaps in the weave that show the frame through. Chewed up screws in the hinges look like someone took them out and put them back in several times... or salvaged them from another unit. On the whole, it doesn't seem sturdy. I'll be folding it up and re-deploying it several times a week, so I'll be surprised if it will still stand up in a year. Not a good value for the price, really, except that demand on these right now has prices pushed upward. I'd be happy enough if I'd spent $39.99 rather than over a hundred.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 4, 2021
L
Lorraine
Louisville, US
★★★★★ 4
Smooth, Stable, and Perfect for Flexible Spaces
Size: 88''W-4 Panel, Color: Grey, Size: 88''W-4 Panel, Color: Grey
This room divider is incredibly easy to move thanks to its industrial-grade silent casters. It glides smoothly across different floor types with just one hand and without any noise, while the built-in wheel locks keep it firmly in place once positioned, no slipping or unwanted movement. The base with reinforced steel feet adds impressive stability, preventing wobbling even in busy or high-traffic areas. I also love the foldable design, which makes storage effortless when it’s not in use. It folds down compactly and fits neatly into small spaces. I gave only 4 stars because I'm not crazy about the color of the fabric. Otherwise this is a very functional way to separate areas.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 7, 2026
K
K
Carnegie, US
★★★★★ 5
easy to put together, stable and blocks out unwanted eyes.
Size: 88''W-4 Panel, Color: Grey
If you live in a high rise building, or where there is lots of foot traffic and can see in your windows, this is a must have. It's portable, can fold down one or two walls and easy to move around. Put together once, and block out light and eyes while tall enough to see over. You can fold it up along the wall, and use it to block out the blinds or light when using a projector so that it's darker. You can use it to partician the room if you share one, and separate your pile of junk from your room so you don't look at it, can take quite a bit of towel weight and clothes and doesn't tip over. Sturdy bottom metal and easy to put together. I got the grey one, and glad I did. I use it everyday and is part of my room decor. I love it, and after using it for a few months it's quite durable. The quality is there for sure. A tad pricey, but worth it. Must have for a private person.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 28, 2026
K
KKat 10
Battle Creek, US
★★★★★ 5
Well made dividers.
Size: 88''W-4 Panel, Color: Grey
Very durable and stable. Once positioned, they stay upright and firm and don't wobble around. Good materials on both the panels and the frame that supports it. Great for any partitioning needs and a fair price for the quality you receive. Highly recommended.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 28, 2025

recommand products