SKU: 94141763025

Monkeypox virus A29L, His Tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Monkeypox virus A29L, His TagProduct Specification Species MPXV Synonyms Mpox, Monkeypox Accession Q9YN60 Amino Acid Sequence MDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKHNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYEGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight 14. 2 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Reconstitution Reconstitute no more than 1 mg mL according to

Product Specification


Species MPXV
Synonyms Mpox, Monkeypox
Accession Q9YN60
Amino Acid Sequence

MDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKHNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYEGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight 14.2 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

Use within 1 month, 2 to 8 °C under sterile conditions after reconstitution. 12 months from date of receipt, -20 to -80 °C as supplied. Avoid repeated freeze-thaw cycles.

Background

A29L is highly homologous to Vaccinia virus envelope protein A27. A27 has multiple functions and is conserved in the Orthopoxvirus genus of the poxvirus family. A27 protein binds to cell surface heparan sulfate, provides an anchor for A26 protein packaging into mature virions, and is essential for egress of mature virus (MV) from infected cells. 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 94141763025

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Steven S.
Alexandria, US
★★★★★ 5
Perfect for chewy doggos
My dogs loved them! Keeps them entertained for a few mins. You can also fill with PB and freeze. Or yogurt and freeze. Great for the doggos
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
E
Verified Purchase
Erika
Natrona Heights, US
★★★★★ 5
Amazing!!
The dogs love them!!! They have not been able to destroy them at all!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
B
Verified Purchase
BrandiLynn0311
Grantham, US
★★★★★ 5
Mixed Results: SIHRMIU Dog Chew Toys Offered Stimulation, Limited Interest from Aggressive Chewers
I recently purchased the SIHRMIU 2 Pack Dog Chew Toys for Aggressive Chewers with hopes of providing my energetic dogs with both entertainment and stimulation. While these toys boasted durability and were designed to alleviate boredom, my experience with them yielded mixed results. Upon receiving the chew toys, I appreciated their sturdy construction and the promise of durability, which was essential given my dogs' penchant for aggressive chewing. The variety of textures and shapes seemed promising, offering potential for engaging play sessions that could keep my pets occupied and mentally stimulated. Initially, my dogs showed some interest in the toys, eagerly sniffing and exploring them. They seemed intrigued by the different textures and shapes, and I was hopeful that these toys would provide the entertainment they needed. However, as my dogs began to interact more with the toys, it became evident that their interest was short-lived. While they engaged with the toys for brief periods, they quickly lost interest and returned to their usual chewing favorites. Despite their designation for aggressive chewers, the toys did not seem to withstand the intense chewing of my pets as well as expected. Within a short time, I noticed signs of wear and tear, with pieces starting to break off. While the SIHRMIU dog chew toys offered some stimulation and diversion for my dogs, they ultimately failed to hold their interest or stand up to their aggressive chewing habits. While they may be suitable for dogs with less voracious chewing tendencies, they were not a perfect fit for my pets. In conclusion, while these chew toys have potential and may work well for some dogs, they fell short of expectations for my aggressive chewers. I appreciate the effort put into their design and durability, but unfortunately, they did not meet the needs of my furry companions.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2024
M
Verified Purchase
Michele Johnson
Phoenix, US
★★★★★ 5
Indestructible!
These dog chew toys have been a great purchase! My dog loves them and was interested in them right away. The shapes are fun and easy for my dog to hold while chewing, which keeps them entertained for a long time. The material feels durable and has held up really well even with regular chewing. I also like that it helps keep my dog busy and gives them something safe to chew on instead of furniture or shoes. Getting two toys in the pack is a nice bonus, and they seem well made for the price. Overall, I’m very happy with this purchase and would definitely recommend these chew toys to other dog own
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2026
D
Verified Purchase
Deanna Yanda
Chelsea, US
★★★★★ 5
Indestructible for the heavy chewers in your life!
My dogs can chew anything, and these are still in great shape! Very chew resistant to even my large dogs, and they love them! Easy to wash off if they end up in the food bowl or outside!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026

recommand products