SKU: 94205070077

Human GM-CSF, His tag

Sale price$45.00 Regular price$50.00
Save 10%

Pay in installments of $12.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 10 - Aug 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human GM-CSF, His tagProduct Specification Species Human Synonyms Granulocyte macrophage colony stimulating factor, Colony stimulating factor (CSF), Molgramostin, Sargramostim Accession P04141 Amino Acid Sequence Protein sequence(P04141, Ala18 Glu144, with C 10*His) APARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQEGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 16. 1kDa

Product Specification


Species Human
Synonyms Granulocyte-macrophage colony-stimulating factor, Colony-stimulating factor (CSF), Molgramostin, Sargramostim
Accession P04141
Amino Acid Sequence

Protein sequence(P04141, Ala18-Glu144, with C-10*His) APARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQEGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Theoretical:16.1kDa Actual:17-30kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Granulocyte-macrophage colony-stimulating factor (GM-CSF), also known as colony-stimulating factor 2 (CSF2), is a monomeric glycoprotein secreted by macrophages, T cells, mast cells, natural killer cells, endothelial cells and fibroblasts that functions as a cytokine. Unlike granulocyte colony-stimulating factor, which specifically promotes neutrophil proliferation and maturation, GM-CSF affects more cell types, especially macrophages and eosinophils. It is part of the immune/inflammatory cascade, by which activation of a small number of macrophages can rapidly lead to an increase in their numbers, a process crucial for fighting infection.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 94205070077

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kindle Customer
Belleville, US
★★★★★ 5
Kiss
Format: Kindle
Unexpectedly original for a mafia book. I thought I read them all but I loved Emmy's personality. I liked her toughness and that she didn't give into the three hassholes, Ares, Hades and Vulc. Emmy and her mom were on the run for over a year when they found refuge with The Pantheon. Her mom reconnects with an old HS friend and while Emmy tries to keep to herself. Ares, Hades, and Vulc notice how different Emmy is from the girls they're used to and instantly want to get to know her and protect. But Emmy and her mom have more secrets then the boys knew and protecting her becomes a full time job. Will they get any benefits from being her bodyguards? High heat with a good storyline. Triggers of kidnapping and abuse.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 29, 2021
L
Verified Purchase
Lizzy
Natrona Heights, US
★★★★★ 5
Definitely worth a read
Format: Kindle
This book was everything. It was heart-wrentching, funny, thrilling, sweet, everything. You'll be angry. You'll be sad. You'll be shocked. So much happens and so much is still yet to be explained. I loved it. From the beginning, I was interested in Emmy as a character. She's extremely relatable. She's realistic. She has reactions and feelings that make sense! The boys will make you want to throw things sometimes, but they'll worm their way into your heart eventually. And that ending! Yes! Loved it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 9, 2021
B
Verified Purchase
Bonnie
Port Orchard, US
★★★★★ 5
All The Things!!
Format: Kindle
This is definitely worth reading! The spice is nice, but the story itself is truly an epic literary treat! Tessa and her Alphas are a powerhouse force of nature who will capture your heart. This story is also a great reminder of how fickle life can be and how quickly everything can change for anyone. Every single person, billionaire to janitor, is nothing but one tragic event away from being in the same situation as Tessa was in. ❤️
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 10, 2025
J
Verified Purchase
Jenna
Birmingham, US
★★★★★ 4
Kind of difficult to get through for the first half but worth the read!
Format: Kindle
3.75/5 ⭐️ What this book lacked in being fully polished, it made up for in world and character building for sure! While the first half was hard to get through, as this is a book that starts you in the present and then goes back and forth between different times in the past to get you up to speed with what’s happening in the future (and it’s not all chronological in the past which made it even harder), once all of the book is set in the present, Tessa and her pack, Ryder, Dixon, Mac, and Tray, (and of course Josie the cat,) all begin their journeys of finding themselves both individually and within their pack which is so rewarding to see after all of the tragedy and sadness detailed in their last few years leading up to meeting. I think this book could’ve done with another beta reader or two to polish up grammatical errors as well, some of those took me out of the story for a minute to try to figure out what was trying to be communicated. Overall, this story filled with so many dichotomies of love and loss, grief and happiness, hurt and comfort, all culminating in a lovely story of a pack that strengthens each other after many tribulations, and it warms your heart so so much to see them go through every version of themselves, landing on secure and happy individuals who make a wonderful pack together. Would absolutely recommend if you like slow burn, rockstar, big city, and initially heavy and a bit dark but fades into comfort and fluffy omegaverse stories!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
J
Verified Purchase
j j
Natrona Heights, US
★★★★★ 3
i should have waited for there to be reviews posted
Format: Kindle
I'm being more generous than I should because this is a debut novel i downloaded this book because i like why choose and band romances i figured that it wouldn't take too long to get back to where the prologue was because the prologue seemed to be less than a day before they met the FMC and the MMCs don't meet til 60 % of the way in which for a Romance novel kinda hard for the relationship to develop or for there to be plot beyond them just meeting in a way where the FMC really lacks agency a lot of early plot and character things are forgotten about after they met it's almost as if the last third of the book was written first and then they went back to write backstory separately but forgot there needs to be a plot i get wanting to have background on the characters, but there has to be a way to do it without constant time jumps and no plot progression. Tessa's story jumps around a week lead up so much also the band aspect is very much an afterthought in the novel Spoilers-- one of the MMCs is openly pan and one of them has been dealing with a bi awakening but being somewhat defensive about it and once Tessa arrives that gets forgotten about til the epilogue and even then doesn't actually confront his sexuality the wrap up of the church hiding her name is tied up with a quick sentence, but no real consequences for anyone i honestly thought she forgot about family pack IRS deal until the final chapter and that gets resolved in an unsatisfying way the pack is upset that Tessa gets viewed as an object and tricked into the contract but has no interest in making the company's wrongdoings public or trying to prevent this from happening to other omegas tessa goes over a lot of struggles of homelessness but she only thinks about food waste once after joining the pack -- you'd think she'd use her newfound wealth and power to help other homeless individuals, especially youths and omegas. even a little side note to say that a portion of tour proceeds or her family fortune would go towards public food pantries and shelters would've done something to connect her beginning character to the end character
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 3, 2025

recommand products