SKU: 95217888913

Human BCMA/TNFRSF17 Protein, His Tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human BCMA/TNFRSF17 Protein, His TagProduct Specification Species Human Synonyms Tumor necrosis factor receptor superfamily member 17, B cell maturation protein, CD269, BCM, BCMA Accession Q02223 1 Amino Acid Sequence Protein sequence (Q02223 1, Met1 Ala54, with C His Tag) MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA Expression System HEK293 Molecular Weight Predicted MW: 5. 9 kDa Observed MW: 10, 13 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical

Product Specification


Species Human
Synonyms Tumor necrosis factor receptor superfamily member 17, B-cell maturation protein, CD269, BCM, BCMA
Accession Q02223-1
Amino Acid Sequence

Protein sequence (Q02223-1, Met1-Ala54, with C-His Tag) MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Expression System HEK293
Molecular Weight Predicted MW: 5.9 kDa Observed MW: 10, 13 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 95217888913

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Becky
Chelsea, US
★★★★★ 5
Great product!
Color: Black
Enjoy using this Panel Screen Divider. I would buy again. Very pretty.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
B
Verified Purchase
Bill Foster
Houston, US
★★★★★ 4
Japanese-Style 4-Panel Screen Room Divider: Beautiful, But...
Color: Black, Color: Black
I really like this product, and would gladly recommend it. But there are a few things you want to know before buy: Likes 👍👍👍 - Looks great! See photos I shared. - Works as advertised: divides your space and provides privacy, with elegance and style. - Lightweight: It is super light and easy to move around. Dislikes 👎👎👎 - Flimsy: according to the dictionary, that means "light and easily damaged" 🧐 - Pricey: Anything is worth what you're willing to pay for it! But I think this should be $75 tops! - Shaky: You need to position it just right, or it could tip over really easily. I had to reposition mine because it almost got blown by a floor fan! True story 😅 - Print is on one side only which will bother some of you. I'm a recovering OCD 😂 My Verdict 🧐 - Despite its shortcomings, I like this thing, and I would buy it again! 😅 It has character and really adds to your space. So, now that you know what you're getting, you can make up your own mind! I've already bought mine 😉 Happy shopping 😊 Hope my review has helped you make a more informed buying decision 👍😊👋
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 7, 2022
M
Verified Purchase
Melissa Eagle
Charlottesville, US
★★★★★ 5
Cute backdrop for videos and room separation
Color: Black
Bought this because sometimes you need emotional boundaries AND physical ones. Surprisingly sturdy, looks nice on camera, and makes a room feel more peaceful instantly. Side note I have 2 cats and 2 large dogs and it has took a couple of beatings but did not damage at all!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
M
Verified Purchase
Mia Z. Edwards
Charlottesville, US
★★★★★ 5
Transforming Space: A Tale of Two Stunning Room Dividers
Color: Black, Color: Black
The four-panel screen room divider is absolutely stunning! Unfortunately, the first one the FedEx driver delivered ended up at the wrong address. After notifying Amazon, they promptly sent me a “replacement” room divider through UPS, which arrived right on schedule. Now, I find myself with two beautiful dividers! They both enhance the aesthetic of my home. I informed Amazon that my first room divider magically appeared today in my building’s lobby. I’ve placed one of the new screen dividers in front of an old one, and the modern Roundhill divider really makes my older piece look outdated! The Roundhill screen divider is sleek, bold, and refreshing—I’m in love with it. The second divider serves a practical purpose by hiding my bulky grocery cart, fan, and vacuum cleaner. These items used to clutter my living room closet, making it difficult to access due to the abundance of coats I had stuffed in there. Now, all those items are neatly tucked away behind the elegant Roundhill four-panel screen divider, bringing a sense of order to my space. Thanks, Amazon! ♥️ Thanks, Roundhill! ♥️
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 6, 2026
A
Verified Purchase
Ann W
Draper, US
★★★★★ 5
Beautiful, Sturdy, Well Made, good Value for the money
Color: Black
I don’t know what the bad reviews are about. This is a beautiful, well made 4 panel screen. The screen print appears to be a standard print that is likely the same on every screen they produce (not hand painted by two different people). It is beautiful. Everything about it, including the colors and the screen print image on rice paper, is more lovely than the photos. The wooden frame (black) is solid and sturdy. The hinges are stable and well positioned. When people say lightweight it sounds misleading. It is lightweight enough to easily maneuver but this four panel screen is sturdy and stable. It is slim and tall so someone could conceivably bump into it and jostle it. But no more so than any number of other items in one’s home. I highly recommend this beautiful, lovely, fine piece of home decor. I purchased this as a divider between my work station (office) and my living room. Also, even though there was a slight dent in the package when it was delivered, it wasn’t a deep enough gash to damage the screen. When I pulled the screen from the box my first thought was just how study it is. So very pleased with this purchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 16, 2022

recommand products