SKU: 95389366719

S100A8 Protein, Human

Sale price$91.80 Regular price$102.00
Save 10%

Pay in installments of $25.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

S100A8 Protein, HumanProduct Specification Species Human Synonyms Calgranulin A; Cystic fibrosis antigen; Leukocyte L1 complex light chain; MRP 8 Accession P05109 Amino Acid Sequence Met1 Glu93 MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE Expression System E. coli Molecular Weight 12kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag No Tag Physical Appearance Lyophilized Powder Storage

Product Specification


Species Human
Synonyms Calgranulin-A; Cystic fibrosis antigen; Leukocyte L1 complex light chain; MRP-8
Accession P05109
Amino Acid Sequence

Met1-Glu93 MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

Expression System E.coli
Molecular Weight

12kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag No Tag
Physical Appearance Lyophilized Powder
Storage Buffer

pH7.5,20mMTris,300mM NaCl

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1. . and Anna L Gharibyan (2012) Int J Mol Sci. 13(3):2893-2917

Background

S100A8 protein became the focus of intensive current research due to their association with numerous human disorders, including acute and chronic inflammatory conditions, autoimmune diseases, cancer, atherosclerosis, cardiomyopathies and neurodegenerative diseases, as well as due to their crucial roles in normal physiological processes within cells. S100A8 belongs to the family of low molecular weight S100 proteins (10–13 kDa) comprising 22 members to date and representing the largest subfamily of the EF-hand Ca2+-binding proteins. All S100 proteins share conserved structural motifs of two EF-hand Ca2+-binding domains connected by a variable hinge region that often confer biological activity. The tendency to form homodimers is common to all S100 proteins, including S100A8 and S100A9, with one exception—calbindin D9k is monomeric. Some members of the S100 protein family are also able to form heterodimers as observed f.e. for S100A8 and S100A9 or S100A1 and S100P, which suggests different functions for homo- and heterodimers.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 95389366719

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Silver
San Leandro, US
★★★★★ 5
Works great as advertised
Style: Printer & Inks, Style: Printer & Inks
Working great so far! Enjoying starting doing sublimation work. A rookie a few weeks in and it's going well. Print quality is decent. Not having paper jam issues. Was easy to setup. I had to goto Epson and download a current print driver to get all the print properties and printer settings I needed. Was easy. After I installed the 2nd driver and saw it worked better, then I uninstalled the 1st epson driver. Helped allow for 8.5 x 14 page size and high quality. Just a few options needed that were not showing on the original print driver. Took me a few days to figure out what was going on. It helped with the quality of the prints after I got the better driver. So the end product is better also.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 23, 2026
S
Verified Purchase
Shark
Grantham, US
★★★★★ 5
Prints great, wifi was an issue
Style: Printer & Inks
Got the printer a week ago and have printed something every day so far and the quality of the prints have been fantastic. Arrived and set up without any major issues, other than not being able to connect to my local wifi. Had to get an Ethernet cable to connect to it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
S
Verified Purchase
S. Robson
San Leandro, US
★★★★★ 5
Good printer
Style: Printer & Inks
It is working well for sublimation. No issues so far.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026
C
Verified Purchase
claudia
Birmingham, US
★★★★★ 5
Easy to assemble and quality
Style: Printer & Inks, Style: Printer & Inks
Using my printer almost everyday since Im starting on a sublimation project and I just love it. The printing quality look good The set up was easy and for now Is working 100%
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
N
Verified Purchase
Nadiagne
Alexandria, US
★★★★★ 5
Great 🥰
Style: Printer & Inks, Style: Printer & Inks
The Epson F170 has been ideal for getting started with sublimation. It's easy to use, prints vibrant and defined colors, and has allowed me to personalize various projects with excellent results. As a beginner, it has given me a lot of confidence to learn and create without complications. I definitely recommend it for anyone starting out in sublimation.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2026

recommand products