SKU: 95554049660

Mouse CD152, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD152, his tagProduct Specification Species Mouse Synonyms Cytotoxic T lymphocyte associated antigen 4 (CTLA 4), Cd152 Accession P09793 Amino Acid Sequence Protein sequence (P09793, Glu36 Asp161, with C 10*His) EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 15. 6 kDa Observed MW: 20 30 kDa Purity 95% by SDS PAGE Tag

Product Specification


Species Mouse
Synonyms Cytotoxic T-lymphocyte-associated antigen 4 (CTLA-4), Cd152
Accession P09793
Amino Acid Sequence

Protein sequence (P09793, Glu36-Asp161, with C-10*His) EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 15.6 kDa Observed MW: 20-30 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CTLA-4 or CTLA4 (cytotoxic T-lymphocyte-associated protein 4), also known as CD152 (cluster of differentiation 152), is a protein receptor that functions as an immune checkpoint and downregulates immune responses. CTLA-4 is constitutively expressed in regulatory T cells but only upregulated in conventional T cells after activation – a phenomenon which is particularly notable in cancers. It acts as an "off" switch when bound to CD80 or CD86 on the surface of antigen-presenting cells. The CTLA-4 protein is encoded by the Ctla-4 gene in mice and the CTLA-4 gene in humans.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 95554049660

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Richard S. Meyer
Omaha, US
★★★★★ 5
A quality product
Size: 22
great picture quality
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2026
B
Verified Purchase
Boyd Mckee Kamer
Houston, US
★★★★★ 5
Koorui 34E6UC (34" 3440×1440, 180 Hz, 1000R curved VA panel) — But Missing Info Buyers Should Know
Size: 34"/WQHD/1000R/HDR400
Review: I purchased two of the Koorui 34‑inch curved ultrawide monitors for a dual‑monitor setup, and so far I’m very pleased with them. The picture quality is sharp, the brightness is solid, and the “Normal” color preset looks natural without any adjustments. For the price, these 34‑inch panels deliver very good performance. That said, there are a few important details the product listing and reviews don’t mention — and knowing them ahead of time would have saved me some stress during installation. 1. YES, the 34‑inch model DOES include stand‑offs (spacers) This is not mentioned anywhere in the listing, and even Amazon’s Rufus incorrectly says they are *not* included. They actually come in the small accessory packet with the manual. If you’re mounting these monitors, you will need those stand‑offs because of the recessed VESA pattern. They are already in the box — just not advertised. I rushed to order a separate spacer kit because the listing didn’t mention it, so I’m putting this here to help the next person avoid that. 2. One of my monitors flashed briefly until I disabled FreeSync On one of the two monitors, I noticed a quick bright “flash” when moving the mouse. Turning off Adaptive Sync / FreeSync in the monitor’s menu fixed it instantly. The other monitor didn’t have this issue, so it seems to vary by panel. Not a defect — just something to be aware of if you see flicker or brightness pops. 3. Color and brightness match well once set manually After setting both monitors to the same brightness, contrast, and color mode, they match very well side‑by‑side. The “Normal” color preset looks the most accurate on these VA panels. 4. Build quality and packaging are solid Both monitors arrived well‑protected, and the included cables work fine. The stand is basic, but I’m using monitor arms, so that wasn’t a factor for me. 5. Too early to comment on long‑term support or durability I’ve only had these monitors set up for a few hours, so I can’t speak yet to long‑term reliability or how responsive Koorui’s support is. I’ll update this review if anything changes over time. Bottom line: These 34‑inch Koorui ultrawides are excellent for the price, especially for gaming or a dual‑monitor setup. Just be aware that: - Stand‑offs ARE included (despite the listing not saying so) - FreeSync may need to be turned off on some units - Picture quality is great once you match settings manually - Long‑term support is still unknown If the listing had mentioned the included spacers, it would have saved me a last‑minute order — so I hope this review helps the next person.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 12, 2026
C
Verified Purchase
Conner M.
Cuba, US
★★★★★ 5
Awesome monitor! (my 3 year review)
So I've owned this monitor for about 3 years now and here's what I have to say about this monitor. The picture quality is actually really good. I got the 1080p version and I mostly use it with my Xbox series x and occasionally will use it for some lighter gaming on my gaming PC both work effortlessly well. The screen size is okay I think next time if it's in the budget I'll buy there 34 inch curved monitor. But for right now I'm sticking with this monitor until it dies and so far it's running strong 3 years later. Right now this monitor cost $80 which is an absolute steal at that price. I paid $130 for it and would say it's absolutely worth getting. There's no flickering. The setup process went smoothly. It's compatible with both my console and gaming PC! I absolutely love this monitor! I don't own the 27 inch version but I'd recommend going with either that size or bigger if you can afford it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 10, 2025
S
Verified Purchase
Scotticus Finch
Alexandria, US
★★★★★ 5
Great monitor!
Size: 34"/WQHD/1000R/HDR400
Excellent product and value! Great quality, makes gaming awesome.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
G
Verified Purchase
Greycie
Carnegie, US
★★★★★ 4
Overall AMAZING moniter for the price
Size: 24"/FHD/240Hz
It dose everything it said it did without any downsides thus far. I will say having it grouped with all the other monitors in the listing kinda skews the reviews for all the monitors and the HDR 400 certification not being a real HDR value is a bit scummy for marketing however over all its a amazing monitor. virtually 0 input lantancy as far as i can tell and its more than bright enough for me. Its color calibration is a bit off by default but can be easily fixed by switching to the cool setting. I was expecting it to come with a display port cable but it only came with a HDMI cable. I would have liked to see a display port cable but i understand why its a HDMI cable. It was very easy to setup and easy to use as its just the stand, the monitor, and the HDMI and power cords. The monitor stand is nice but its obviously where Koorui cheaped out however for a monitor of this price you cant beat it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 20, 2025

recommand products