Pay in installments of $72.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 10 - Aug 15
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
CLEC7A Fc Chimera Protein, HumanProduct Specification Species Human Antigen CLEC7A Synonyms BGR, CANDF4, CD369, CLECSF12, DECTIN1, SCARE2 Accession Q9BXN2 Amino Acid Sequence Thr66 Met247, with C terminal Human IgG Fc
Product Specification
| Species | Human |
| Antigen | CLEC7A |
| Synonyms | BGR, CANDF4, CD369, CLECSF12, DECTIN1, SCARE2 |
| Accession | Q9BXN2 |
| Amino Acid Sequence |
Thr66-Met247, with C-terminal Human IgG Fc TMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSMIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Expression System | HEK293 |
| Molecular Weight | 55-72kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | Human Fc Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1.Yaqiong Wang,Xianzhe Li, Xialian Xu,Jinbo Yu, Xiaohong Chen, Xuesen Cao,Jianzhou Zou,BoShen and Xiaoqiang Ding. Clec7a expressionin inflammatory macrophages orchestrates progression of acute kidney injury. Frontiers in Immunology. |
Background
C-type
lectin domain family 7 member A (Clec7a, or Dectin-1) is a transmembrane
protein containing an intracellular immunoreceptor tyrosine-based activation (ITAM)-like
motif and an extracellular C-type lectin-like domain for recognition. Clec7a is
expressed by macrophages and some other immune cells and is believed to control
the innate immune responses to pathogens and the phagocytotic properties, through
regulating phagocytosis and production of reactive oxygen species (ROS).
Moreover, a recent study has shown that Clec7a is critical for macrophage
polarization during renal interstitial fibrosis.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy