Pay in installments of $41.88 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 15 - Aug 20
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human SFTPA2 Protein, His TagProduct Specification Species Human Synonyms Pulmonary surfactant associated protein A2, PSP A, PSPA, SP A, SP A2, 35 kDa pulmonary surfactant associated protein, Alveolar proteinosis protein, Collectin 5, COLEC5, PSAP, SFTP1, SFTPA, SFTPA2B Accession Q8IWL1 Amino Acid Sequence Protein sequence (Q8IWL1, Glu21 Phe248, with C His Tag)
Product Specification
| Species | Human |
| Synonyms | Pulmonary surfactant-associated protein A2, PSP-A, PSPA, SP-A, SP-A2, 35 kDa pulmonary surfactant-associated protein, Alveolar proteinosis protein, Collectin-5, COLEC5, PSAP, SFTP1, SFTPA, SFTPA2B |
| Accession | Q8IWL1 |
| Amino Acid Sequence | Protein sequence (Q8IWL1, Glu21-Phe248, with C-His Tag) EVKDVCVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPMGPPGETPCPPGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 25.8 kDa Observed MW: 33-40 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Physical Appearance | Lyophilized powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
Pulmonary Surfactant-Associated Protein A2 (SP-A2) is a critical component of pulmonary surfactant, a lipoprotein complex essential for reducing surface tension in the alveoli and preventing lung collapse. Encoded by the SFTPA2 gene, it is primarily synthesized and secreted by type II pneumocytes. SP-A2 is a collectin, characterized by its collagen-like domain and carbohydrate recognition domain, which enables its key role in innate host defense. It opsonizes pathogens, enhances phagocytosis by alveolar macrophages, and modulates inflammatory responses. Genetic variants in SFTPA2 are associated with susceptibility to respiratory diseases, including pulmonary fibrosis, respiratory distress syndrome, and increased risk of severe lung infections.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy