SKU: 96495076083

FOLR1 Fc Chimera Protein, Human

Sale price$288.00 Regular price$320.00
Save 10%

Pay in installments of $80.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 21 - Jul 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FOLR1 Fc Chimera Protein, HumanProduct Specification Species Human Accession P15328 Amino Acid Sequence Arg25 Met233, with C terminal Human IgG Fc RAWARTNVCMNAKHHKKGDKHCRWRKNACCSTNTSAHKDVSYYRNWNHCGMAACKRHDTCYCSNGWVDSWRKRVNVCKDCWWDCRTSYTCKSNWHKGWNWTSGNKCAVGAACHYTTVCNWTHSYKVSNYSRGSGRCMWDAGNNVARYAAAMGGGSGGGSKSSDKTHTCCAGGSVKKDTMSRTVTCVVVDVSHDVKNWYVDGVVHNAKTKRYNSTYRVVSVTVHDWNGKYKCKVSNKAAKTSKAKGRVYTSRDTKNVSTCVKGYSDAVWSNGNNYKTTVDSDGSYSKTVDKSRWGNVSCSVMHAHNHYTKSSSGK Expression System HEK293

Product Specification


Species Human
Accession P15328
Amino Acid Sequence

Arg25-Met233, with C-terminal Human IgG Fc RAWARTNVCMNAKHHKKGDKHCRWRKNACCSTNTSAHKDVSYYRNWNHCGMAACKRHDTCYCSNGWVDSWRKRVNVCKDCWWDCRTSYTCKSNWHKGWNWTSGNKCAVGAACHYTTVCNWTHSYKVSNYSRGSGRCMWDAGNNVARYAAAMGGGSGGGSKSSDKTHTCCAGGSVKKDTMSRTVTCVVVDVSHDVKNWYVDGVVHNAKTKRYNSTYRVVSVTVHDWNGKYKCKVSNKAAKTSKAKGRVYTSRDTKNVSTCVKGYSDAVWSNGNNYKTTVDSDGSYSKTVDKSRWGNVSCSVMHAHNHYTKSSSGK

Expression System HEK293
Molecular Weight

60-68kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

A biomarker of recent interest in the cancer field is folate receptor alpha (FOLR1), a membrane-bound protein with high affinity for binding and transporting folate into cells.  FOLR1 is a glycosyl phosphatidylinositol connected membrane glycoprotein, consisting of 257 amino acids. The FOLR1 gene is formed of seven exons and 2 independent tissue-specific promoters, promoter 1 (P1) at the exon 1 and promoter 4 (P4) at the exon 4 whose utilization is tissue-specific. The gene is located on chromosome 11q13.3-14.1. The protein is completely exposed to extracellular molecules and anchored at the cell membrane by GPI. FOLR1 is involved in DNA replication and damage repair. FOLR1 mediates cellular responses to folate, including cell division, proliferation, and tissue growth. Overexpression of FOLR1 may confer a growth advantage to tumors by increasing folate uptake and/or may affect cell proliferation via alternative cell signaling pathways. FOLR1 levels have been found to be elevated in tumors of epithelial origin compared to normal tissue, including ovarian, breast, brain, lung and colorectal cancers. FOLR1 protein expression was lowest in normal ovarian tissue, higher in benign ovarian tumors, and highest in malignant tumors. Folate receptor alpha (FOLR1) has been identified as a potential prognostic and therapeutic target in a number of cancers.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 96495076083

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
H
Verified Purchase
Havinne Akins
Belleville, US
★★★★★ 5
😍😍 BEST DEBUT NOVEL EVER
Format: Paperback
I’m having trouble finding accurate words to describe the way this book made me feel, but I am going to do my best. To start off with basic elements, the character and world building are phenomenal. I feel a strong bond to not only the two main characters, Ara and Rogue, but to each and every character introduced throughout the book. The author did a stellar job of giving each of them unique personhood. All of the scenes are beautifully described. So much so that throughout the entirety of the book, I could see every scene: the towns, the castles, the meadows, the landscape. I have had difficulty with this and with distinguishing between outlying characters while reading in the past, but I did not have to think to remember details of world or character building because they flowed naturally within the story and were described well. I have read book series before that made me want to be a part of that world, but I actually felt like I got to step into Auryna and Ravaryn! The plot twists!! Although this is not a suspense novel, it still had me on a rollercoaster of emotions and on the edge of my seat from beginning to end. I haven’t cried actual tears over a book since I was in high school (and I’ve read a LOT). This book finally broke the floodgates in the final few chapters. Multiple times. And we love a good cliffhanger. It truly made me FEEL. THE SPICE is a solid 3.5/5. Some of the scenes had me flushed, some had me taking notes, some just had my jaw slack and my mouth hanging open. Bravo, JD Linton, bravo. The relationships: friendships, family, romantic, ALL of the relationships in this book have so much meaning. The author does a great job at making you feel the love, the anger, the peace, the frustrations, the safety, the familiarity, etc. between the characters. Ara and Rogue. I can not say enough and I also do not want to say too much. Just know that I feel like I know them both, to their core. I know what their childhood looks likes, their darkest moments, their biggest fears, their dreams and passions, what they want in life… The POV switches were seamless. I am so happy this author decided to let us see from both sets of eyes. I can not wait for book two after that cliffhanger. And there is SO much potential for at least one prequel, I can’t wait to see where this author goes! I hope this series continues and flourishes. Fingers crossed!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 5, 2022
T
Verified Purchase
Tracy and Christina
Battle Creek, US
★★★★★ 5
Amazing!
Format: Kindle, Format: Kindle
This book was phenomenal, I devoured it within a few days! For this being a debut novel, it is fantastic and I would’ve thought the author was a seasoned author. I have zero complaints about this book. Let me start by saying that the world building was phenomenal. I could picture everything in my head because of how detailed it was — that’s how good it was written. And I absolutely love the “captive/captor” trope so much, it’s become one of my favorite tropes, so I was pleasantly surprised to see that this book had that. I loved the banter between Rogue and Ara — they’re both snarky and witty, plus with the romantic tension, it made the dialogue that much better. Speaking of romantic tension, yes there is spice but not so much of it that it overrides the plot, which I loved. For me, this would probably be on the 3/5 level of spice. This book had a ton of plot twists and I thoroughly enjoyed it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 13, 2024
R
Verified Purchase
R Spires
Grantham, US
★★★★★ 4
High on Tropes and Satisfaction
Format: Kindle
This is a great Romantasy book full of action, adventure, and everything you look for in this genre. I won’t lie: it does kinda feel like the author found every common trope from every successful book of this kind and threw them all into this novel. But if it ain’t broke, don’t fix it. Especially in romance, there’s a large audience who has specific expectations, and they want them every time. Nothing wrong with that and many times I’m one of them. I have no idea what defines a spoiler honestly, so spoiler alert!!!!!!! Tropes include: Only one bed at the inn/bar Dissatisfaction with life before hunk appears Lost royalty The chosen one Montage of dress up time followed by shocked hunk Forbidden romance between two from rival peoples Power that cannot be controlled, simply guided/asked Gathering intel at the inn/bar FMC who knows how to fight/use weapons well There’s probably more but no need to list them all. Good story and I would recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 14, 2024
L
Verified Purchase
Lisa B.
Whiting, US
★★★★★ 5
OUTSTANDING
Format: Kindle
This was very, very good. The world is vast and characters are complex. There is a good plot with a whole lot going on. This is well written. Good twists and turns and some heart breaking moments. You will love these characters, they have heart and loyalty. I am hoping that there will be several more books. We've yet to see anything from the Sea Court but only a mention of them here and there. The Wood Court was given a quick couple of scenes, and only as far as some warriors, we've yet to enter their court and the Shadow Court, I'm not sure if they will be a force for good or bad, but they definitely will play a much bigger role moving forward. This is primarily the Ice and Air Courts. Told in multiple views, which I loved, it gives you a chance to see things from different eyes. There's alot of political maneuvering and deception. I loved it and will pick up the next book as it becomes available. If you like The Fae and the courts, you should love this. I think the author has mucn in store for us.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2020
J
Verified Purchase
Jessika
Omaha, US
★★★★★ 4
Definitely worth the read!
Format: Kindle
After taking a deep breath and taking in that wicked twist of an ending, I have finally composed myself. My first thought when I started this book was that I love Reyna's character. I was intrigued by her connection with her familiar and the Ruin that is plaguing her land. It came as no surprise that she took her sister's place in an attempt to protect her. When they reach the Air Court everything slows down. This is where it was iffy for me. First of all, I like multiple POV's in books however 7 is a bit much. It starts to interrupt the story line. I felt like I was finally making progress connecting with one character, then it was switched to another person. I felt they all had necessary or pertinent information but not necessarily were they all POV worthy. The only other thing that annoyed me was that Reyna constantly was " trapped." She would rush off without thinking, only to need rescuing. She is brilliant in a fight, but she really doesn't think through anything. Lorcan is amazing. I know he might be on the "bad" list, but his background is so interesting. Eislyn(Reyna's sister) is really so sweet, but calculating. I enjoyed her and Thane's dialogue. The author did an amazing job with the imagery in this book. Everything was so detailed it was easy to fall into the scene. I love unexpected twists and while part of the ending I expected, I wasn't expecting how it took place. All in all, I found it very entertaining and I am very invested in continuing this series. Favorite quotes: "The truth may be twisted but never false." "Who was she if she was not the enemy of the Air Court? What was her purpose of she no longer has that?" "In a war-torn land, love was always a lie."
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 4, 2020

recommand products