Pay in installments of $170.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 11 - Aug 16
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
GCGR Fc Chimera Protein, HumanProduct Specification Species Human Accession P47871 1 Amino Acid Sequence Ala26 Lys136, with C terminal human IgG Fc
Product Specification
| Species | Human |
| Accession | P47871-1 |
| Amino Acid Sequence | Ala26-Lys136, with C-terminal human IgG Fc AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Expression System | HEK293 |
| Molecular Weight | 57-67 kDa(Reducing) |
| Purity | ＞90% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | Human Fc Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
The glucagon receptor (GCGR) is a Class B GPCR that has an important role in maintenance of glucose homeostasis and, as such, is considered to be a valuable target for the treatment of diabetes. The GCGR is widely expressed and can be found in the liver, adipose tissue, heart, kidney, pancreatic islets, stomach, small intestine, thyroid, and skeletal muscle. The GCGR is coupled to the activation of adenylate cyclase via Gs, with concomitant rise in cellular cyclic AMP levels and activation of protein kinase A (PKA). GCGR mRNA has been detected in islets. In vitro/ex vivo studies suggest that glucagon potentiates insulin secretion from isolated islets, although the potency is considerably less than that of the insulin secretagogue GLP-1. Mutations of the GCGR gene are associated with congenital noninsulin-dependent diabetes, and inhibition of GCGR in vivo lowers blood glucose and improves glucose tolerance in obese diabetic mice.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy